api Remote Jobs

686 Results

17d

Senior Frontend Engineer

BloomreachBratislava, Slovakia/Prague, Czech Republic/Brno, Czech Republic (Remote CEE)
remote-firstDesignswiftuiapiUXgitc++typescriptcssangularjavascriptfrontend

Bloomreach is hiring a Remote Senior Frontend Engineer

Bloomreach is the world’s #1 Commerce Experience Cloud, empowering brands to deliver customer journeys so personalized, they feel like magic. It offers a suite of products that drive true personalization and digital commerce growth, including:

  • Discovery, offering AI-driven search and merchandising
  • Content, offering a headless CMS
  • Engagement, offering a leading CDP and marketing automation solutions

Together, these solutions combine the power of unified customer and product data with the speed and scale of AI optimization, enabling revenue-driving digital commerce experiences that convert on any channel and every journey. Bloomreach serves over 850 global brands including Albertsons, Bosch, Puma, FC Bayern München, and Marks & Spencer. Bloomreach recently raised $175 million in a Series F funding round, bringing its total valuation to $2.2 billion. The investment was led by Goldman Sachs Asset Management with participation from Bain Capital Ventures and Sixth Street Growth. For more information, visit Bloomreach.com.

 

Do you love frontend development and are you good at it? Would you like to build a large-scale & fast evolving app using Angular & TypeScript? Would you like to talk about why we might be the best team for you to join right now?? Curious? Read on!
(Your s
alary starts from 3300€ per monthwith stock options and other benefits included. Working in one of ourCentral Europe offices or from homeon afull-time basis.)

What tech stack do we have for you?

  • Typescript and Javascript
  • Angular
  • SCSS/CSS
  • NodeJS
  • RxJS
  • Karma/Jasmine/Cypress
  • GIT

About your role and the team:

We are a team of thirteen people at the moment. We cooperate tightly as a single unit on a multitude of tasks and challenges in order to make our application the best to serve our customers’ needs. Since not all of us enjoy tasks with a focus on styling, a subteam of stylers has been formed that takes care of our UI library of low-level components. 

We are facing a variety of tasks on our daily basis that fall mostly into three categories - designing and developing new features, maintaining existing features in the underlying codebase and sometimes prototyping new features as POCs.

What we expect of the candidate:

Must have

  • advanced TypeScript (or JavaScript with a strong will to switch to TypeScript)
  • advanced Angular (or similar component-based framework with a strong will to switch to Angular)
  • experience with software design & architecture (be able to propose and implement an effective & efficient solution based on problem definition without detailed instructions)
  • The ability to work in project teams effectively, being reliable and communicating clearly.
  • A “can-do” attitude

Should have

  • experience with developing bigger projects
  • At least an intermediate skill with SCSS / CSS (be able to get things done in reasonable quality if your styler colleagues are busy)

Preferably have

  • experience with testing (Karma, Jasmine, Cypress)
  • experience with RxJS

Nice have

  • experience with mentoring less experienced colleagues

How we work:

Our entire engineering team works in 6 week cycles. Each developer is assigned to one or more projects during this cycle and aims to deliver the project together with other project team members from various other teams. In addition to working on projects, we also focus on other tasks - not limited to working on our backlog, providing an L3 support to our client facing colleagues or making improvements to our product through an initiative called “Happy consultants”.
In order to keep our high quality standards, each change in code we do gets reviewed and our automated pipeline builds these changes, runs a series of tests, runs the linter, packages the outputs and deploys them onto a development environment.
We are a team of diverse skill sets - you will need to share your experience and knowledge (during code reviews and ideally also beyond) with other colleagues and help them grow just like we all will help and support you from the minute you join us.

Challenges:

Here are some of the challenges that kept us busy in the past:

  • Micro frontend research
    • Our application is split up into modules but we are experimenting with the idea of loosening up the coupling even a bit more and splitting our large application into a collection of smaller ones run under a single container application.
    • Identify the pros and cons of this approach and what problems will it solve effectively and what other problems it might bring.
    • Take into account how this switch potentially affects not the architecture alone but also the execution, deployment and DX.
  • Optimizing build performance
    • The larger an application gets, the more complex the build becomes. Our application consists of hundreds of components, directives, services, pipes and other functions.
    • Find a way to optimise the build in order to make the DX and the pipeline build performance better.
  • Optimizing change detection
    • Our application aims to deliver a swift interaction experience to its users without the feeling that something is lagging.
    • Identify components that are underperforming.
    • Analyze their bottlenecks using the profiler.
    • Optimize the runtime performance of the problematic code parts.
  • Data visualisation
    • Our real-time analyses like trends, funnels, reports, and segmentations allow users to gain insights about their data from multiple perspectives. We integrate with external data sources spanning multiple relational databases and big data storage systems.
    • Build an interface for users to query data from data sources located outside of the Engagement to build the basis for our analyses and visualizations.
    • Create complex data visualizations using the Highcharts library or similar suitable tool.
    • Be proactive in proposing solutions which will help users to better understand their data.
    • Improve test quality and extend test coverage.
  • Extend UI library
    • We have created a mature UI library with the goal in mind to unify the look, behavior, and the API of our reusable components. This library already consists of a solid foundation of components but the innovation in the Engagement goes hand in hand with the need to create new components and enhance existing ones.
    • Create new reusable components while focusing on clear API, stability, best possible UX and modern browser support.
    • Test your component well. Use unit tests to cover all thinkable and unthinkable scenarios your component may go through to make it robust.
  • Other than that…
    • We work hard to have sustainable code, but we still have some code in our codebase, especially from the early startup era, that was written in haste to keep the business running - you will need to be able to get around in complex code and help us refactor it.
    • Automated testing of our code is important to us. You will need to cover your code, help us improve existing test quality and extend overall test coverage - spanning from unit tests, through integration tests to automated e2e tests.

Regional benefits:

  • Monthly lunch entitlement by up to 110€ per month
  • Pension scheme or Health insurance depending on region

#LI-DU1

More things you'll like about Bloomreach:

Culture:

  • A great deal of freedom and trust. At Bloomreach we don’t clock in and out, and we have neither corporate rules nor long approval processes. This freedom goes hand in hand with responsibility. We are interested in results from day one. 

  • We have defined our5 valuesand the 10 underlying key behaviors that we strongly believe in. We can only succeed if everyone lives these behaviors day to day. We've embedded them in our processes like recruitment, onboarding, feedback, personal development, performance review and internal communication. 

  • We believe in flexible working hours to accommodate your working style.

  • We work remote-first with several Bloomreach Hubs available across three continents.

  • We organize company events to experience the global spirit of the company and get excited about what's ahead.

  • We encourage and support our employees to engage in volunteering activities - every Bloomreacher can take 5 paid days off to volunteer*.
  • TheBloomreach Glassdoor pageelaborates on our stellar 4.6/5 rating. The Bloomreach Comparably page Culture score is even higher at 4.9/5

Personal Development:

  • We have a People Development Program -- participating in personal development workshops on various topics run by experts from inside the company. We are continuously developing & updating competency maps for select functions.

  • Our resident communication coachIvo Večeřais available to help navigate work-related communications & decision-making challenges.*
  • Our managers are strongly encouraged to participate in the Leader Development Program to develop in the areas we consider essential for any leader. The program includes regular comprehensive feedback, consultations with a coach and follow-up check-ins.

  • Bloomreachers utilize the $1,500 professional education budget on an annual basis to purchase education products (books, courses, certifications, etc.)*

Well-being:

  • The Employee Assistance Program -- with counselors -- is available for non-work-related challenges.*

  • Subscription to Calm - sleep and meditation app.*

  • We organize ‘DisConnect’ days where Bloomreachers globally enjoy one additional day off each quarter, allowing us to unwind together and focus on activities away from the screen with our loved ones.

  • We facilitate sports, yoga, and meditation opportunities for each other.

  • Extended parental leave up to 26 calendar weeks for Primary Caregivers.*

Compensation:

  • Restricted Stock Units or Stock Options are granted depending on a team member’s role, seniority, and location.*

  • Everyone gets to participate in the company's success through the company performance bonus.*

  • We offer an employee referral bonus of up to $3,000 paid out immediately after the new hire starts.

  • We reward & celebrate work anniversaries -- Bloomversaries!*

(*Subject to employment type. Interns are exempt from marked benefits, usually for the first 6 months.)

Excited? Join us and transform the future of commerce experiences!

If this position doesn't suit you, but you know someone who might be a great fit, share it - we will be very grateful!


Any unsolicited resumes/candidate profiles submitted through our website or to personal email accounts of employees of Bloomreach are considered property of Bloomreach and are not subject to payment of agency fees.

 #LI-Remote

See more jobs at Bloomreach

Apply for this job

18d

Senior Product Manager

agilesqlscrumapiUX

Integral Ad Science is hiring a Remote Senior Product Manager

Integral Ad Science (IAS) is a leading global media measurement and optimization platform that delivers the industry’s most actionable data to drive superior results for the world’s largest advertisers, publishers, and media platforms. IAS’s software provides comprehensive and enriched data that ensures ads are seen by real people in safe and suitable environments, while improving return on ad spend for advertisers and yield for publishers. Our mission is to be the global benchmark for trust and transparency in digital media quality. For more information, visit integralads.com.

We are looking for a Product Manager to create, develop, and bring a new data measurement marketplace to the AdTech ecosystem. This exciting role will be focused on providing our customers with a way of aggregating data points from a variety of partners into a holistic, scalable solution. 

The ideal candidate has the track record of inspiring and energizing teams to create future visions of the product, articulating customer problems and market opportunities, analyzing industry trends, making priority decisions and clarifying trade-offs, and working with your colleagues across roles to break that down into an adaptable plan that delivers value to our customers. Innovation and challenging the status quo are in our team’s DNA. We are looking for someone who can bring fresh perspectives to drive product innovation. 

What you’ll get to do:

  • Develop products and features that help marketers leverage our rich impression level data into actionable insights with delightful design.
  • Build a 1st & 3rd party partner data/measurement ecosystem for commercial offerings, & evaluate the best path to create value, integrate (data in) or syndicate data (data out).
  • Define and lead execution of API & Data Product strategy through close collaboration with Engineering, Data Science, Business Development, and Sales
  • Create new revenue streams by launching and shipping new data products to market
  • Lean into previous cross Channel Attribution experience, including ROI measurement in order to measure lift using attribution windows and synthetic test & control groups
  • Driving continued functionality and improvement of IAS Signal, our unified reporting platform
  • Guide day-to-day development within an agile / scrum environment
  • Perform analyses, seek user feedback, collect/generate ideas and prioritize for development
  • Collaborate with internal stakeholders - engineering, business development, data science, and product peers to refine opportunities and roadmap
  • Define detailed requirements and groom the corresponding backlog to deliver features used by large advertisers and advertising platforms across the globe
  • Define, manage, and track key product delivery KPIs
  • Partner with UX Designers and Researchers 

You should apply if you have most of this experience: 

Bachelor’s degree in Engineering or other related field

  • Prior experience working within a data analytics environment, visualization experience is a plus
  • 5+ years of hands-on product management experience and collaborating directly with development teams
  • Familiar with LLM and ML models and concepts
  • Proven experience shipping high-quality products with measurable impact
  • Experience within an Agile product development environment with an emphasis on continuous improvement

Intellectual curiosity, passion for learning new technology, able to identify market trends

  • A track record of building, maintaining, and managing strong relationships within an international business and across many different stakeholder groups
  • Strong written and verbal communication skills and the ability to communicate technical concepts to technical and non-technical audiences
  • Working knowledge of SQL, Snowflake, and/or data-bricks is a plus

About Integral Ad Science

Integral Ad Science (IAS) is a leading global media measurement and optimization platform that delivers the industry’s most actionable data to drive superior results for the world’s largest advertisers, publishers, and media platforms. IAS’s software provides comprehensive and enriched data that ensures ads are seen by real people in safe and suitable environments, while improving return on ad spend for advertisers and yield for publishers. Our mission is to be the global benchmark for trust and transparency in digital media quality. For more information, visit integralads.com.

Equal Opportunity Employer:

IAS is an equal opportunity employer, committed to our diversity and inclusiveness. We will consider all qualified applicants without regard to race, color, nationality, gender, gender identity or expression, sexual orientation, religion, disability or age. We strongly encourage women, people of color, members of the LGBTQIA community, people with disabilities and veterans to apply.

California Applicant Pre-Collection Notice:

We collect personal information (PI) from you in connection with your application for employment or engagement with IAS, including the following categories of PI: identifiers, personal records, commercial information, professional or employment or engagement information, non-public education records, and inferences drawn from your PI. We collect your PI for our purposes, including performing services and operations related to your potential employment or engagement. For additional details or if you have questions, contact us at compliance@integralads.com.

To learn more about us, please visithttp://integralads.com/ 

Attention agency/3rd party recruiters: IAS does not accept any unsolicited resumes or candidate profiles. If you are interested in becoming an IAS recruiting partner, please send an email introducing your company to recruitingagencies@integralads.com. We will get back to you if there's interest in a partnership.

#LI-Remote

See more jobs at Integral Ad Science

Apply for this job

18d

Senior Software Engineer, Full-stack

TaniumRemote, Canada
agileBachelor's degreesalesforceDesigngraphqlapigitrubyjavac++jenkinspythonbackendNode.js

Tanium is hiring a Remote Senior Software Engineer, Full-stack

The Basics

As a Senior Software Engineer at Tanium, you will build and maintain best-of-breed products as part of a nimble development team. Tanium focuses on a customer engagement model and feedback process to ensure our products are designed the right way from the beginning. When new products ideas are identified, our software engineers design, develop, test, and deploy the products from the ground up, while iterating with product management and customers for feedback and input.

What you'll do

  • Build and maintain Tanium's products alongside an agile development team
  • Design, develop and test new product ideas from the ground up while working with product management for feedback and input
  • Work on small teams that tackle big challenges in common components like a common data service tasked with unifying and consolidating endpoint data across the entire ecosystem, handling time series data that drive dashboarding and reporting, and exposing data externally through GraphQL enabling partners (like Salesforce) to easily integrate
  • Delivering higher level services enabled by our core services that directly enable our products and focus on everything from security to operations to auditing

 

Education

  • Bachelor's degree or equivalent experience
  • CS Degree preferred

Experience

  • 5+ years industry experience
  • Experience designing and building high-impact, high-performance, scalable, observable, and maintainable backend services and APIs 
  • Knowledge of at least one of Golang (preferred), Node.js, Python, Ruby, Rust, or Java
  • Experience with HTTP API design and development
  • Experience with modern software engineering development and automation tools like git and Jenkins

Other

  • Demonstrates sound judgment for balancing between rapid development, long-term code maintainability and supportability
  • Believes in the power of and the need for writing automated tests as part of development
  • Experienced debugger who can put out fires under pressure when things go wrong in production environments
  • Has knowledge of a variety of modern software frameworks (server side & browser side) and the versatility to learn new tools

About Tanium 

Tanium, the industry’s only provider of converged endpoint management (XEM), leads the paradigm shift in legacy approaches to managing complex security and technology environments. Only Tanium protects every team, endpoint, and workflow from cyber threats by integrating IT, Operations, Security, and Risk into a single platform that delivers comprehensive visibility across devices, a unified set of controls, and a common taxonomy for a single shared purpose: to protect critical information and infrastructure at scale. Tanium has been named to the Forbes Cloud 100 list for six consecutive years and ranks on Fortune’s list of the Best Large Workplaces in Technology. In fact, more than half of the Fortune 100 and the U.S. armed forces trust Tanium to protect people; defend data; secure systems; and see and control every endpoint, team, and workflow everywhere. That’s the power of certainty. Visit www.tanium.com and follow us on LinkedIn and Twitter.

On a mission. Together. 

At Tanium, we are stewards of a culture that emphasizes the importance of collaboration, respect, and diversity. In our pursuit of revolutionizing the way some of the largest enterprises and governments in the world solve their most difficult IT challenges, we are strengthened by our unique perspectives and by our collective actions.   

We are an organization with stakeholders around the world and it’s imperative that the diversity of our customers and communities is reflected internally in our team members. We strive to create a diverse and inclusive environment where everyone feels they have opportunities to succeed and grow because we know that only together can we do great things. 

Each of our team members has 5 days set aside as volunteer time off (VTO) to contribute to the communities they live in and give back to the causes they care about most.   

What you’ll get

The annual base salary range for this full-time position is C$95,000 to C$280,000. This range is an estimate for what Tanium will pay a new hire. The actual annual base salary offered may be adjusted based on a variety of factors, including but not limited to, location, education, skills, training and experience.

 

 

For more information on how Tanium processes your personal data, please see our Privacy Policy.

See more jobs at Tanium

Apply for this job

18d

Python DevOps Developer H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
agilejiraterraformansibleazureapigitc++dockerkuberneteslinuxjenkinspythonAWS

Devoteam is hiring a Remote Python DevOps Developer H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que Python DevOps Developer 

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

  • Comprendre le besoin utilisateur et y répondre en livrant régulièrement des fonctionnalités ayant de la valeur métier,

  • Assurer le développement d’outils visant à industrialiser/automatiser le déploiement sur les différents environnements du développement à la production (conception & structuration, qualité de code, pair-programming, revue de code…),

  • Accompagner les équipes de dev par la mise en place de pipelines CI/CD, d’Infra As code et de conteneurs pour leurs applications,

  • Accompagner les équipes de production dans la mise en place de bonnes pratiques de delivery de ces outils (gestion de sources, gestion de configuration, automatisation des tests…) ;

  • Apporter la culture du développement agile dans les différentes features teams, faciliter la coopération et l'entraide, partager la connaissance via les outils

  • Intervenir au sein d’écosystèmes techniques DevOps et des plateformes de CI/CD complexes pour des milliers d’utilisateurs 

  • Assurer une veille technologique et s'intéresser aux nouvelles pratiques émergentes

Selon les projets, voici les technologies que vous serez amené.e à rencontrer :

  • Scripting : Python, Bash, Shell

  • Programmation : Python, Django, Flask

  • Architectures orientées services (MicroServices & REST API)

  • CI/CD : Gitlab, GitHub, Jenkins, Nexus, Sonarqube

  • Versionning : Git

  • Containers : Docker, Kubernetes

  • Infrastructure As Code : Terraform, Ansible

  • Collaboration : Jira, Confluence

  • Tests : Selenium

  • Système : Windows, Linux

  • Cloud : AWS, AZURE, GCP

Qualifications

Ce que vous apporterez à la Tribu ?

[Les compétences idéales] 

Diplômé.e d’une École d’Ingénieurs ou d’un Master 2 en IT, vous êtes passionné.e par le langage Python dans des contextes Cloud / DevOps et avez au moins 3 ans d’expérience en scripting ou développement sur Python 3 et ses librairies. Que vous veniez du Dev, des Ops, du DevOps, vous avez acquis de solides compétences en automatisation et amélioration continue.

Vous avez déjà une première expérience dans l’utilisation ou la mise en place d’outils de l’écosystème DevOps - CI/CD et vous souhaitez aller plus loin sur ces sujets.

[Cherries on the cake????]

  • Une expérience des frameworks Flask & Django et des outils d’industrialisation (Git, Jenkins, Ansible, Docker…)

  • Une expérience en utilisation ou implémentation de plateformes CI/CD avec des composants “Enterprise” (GitLab / GitHub)

  • Des connaissances et de la pratique en conteneurisation et sur un Cloud provider 

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

18d

Senior Test Engineer with experience in Web and API application Testing

MobicaWarsaw, Poland, Remote
agile5 years of experiencejiraDynamicsDesignuiscrumapiqa

Mobica is hiring a Remote Senior Test Engineer with experience in Web and API application Testing

Job Description

Our Customer is a leading global provider of cutting-edge payments technology solutions, dedicated to shaping the future of financial transactions worldwide. With a commitment to innovation and excellence, we connect consumers, businesses, financial institutions, and governments in over 200 countries and territories through our advanced processing networks.

We are currently looking for a Test Engineer to join the Test Engineering team which is responsible for managing system requirements, design, development, integration, quality assurance, implementation, and maintenance of corporate applications.

The team works closely with business owners of these services to deliver industry-leading packaged software and customer-developed solutions. The diversity of applications provides incredible opportunities to learn multiple aspects of the business while gaining experience across a wide variety of technology stacks.

As a team member you will:

  • Collaborate with developers and QA engineers in agile development framework.
  • Build strong relationships with external teams with a goal of developing robust end-to-end test coverage.
  • Work with the team to increase the test coverage.
  • Execute test cases during all stages of development and release cycle.
  • Design and executing test plans, scenarios, and scripts.
  • Identify process deficiencies and suggest improvements.
  • Conduct test plan reviews with QA leads and stakeholders.
  • Document software defects, using a bug tracking system, and report defects.
  • Determine risks to test deliverables and create mitigation plans.
  • Monitor bug resolution efforts and track successes.
  • Define test parameters, design tests, interpret test results and analyze test trends.
  • Assist in managing the test platforms. 
  • Work with QA leads to develop and improve effectiveness of automation.

This is a hybrid work opportunity, requiring attendance at the customer's office in Warsaw twice a week for team relationship-building purposes.

Due to the nature of our work in the financial market, candidates will be subject to detailed background screening including education, employment history, and criminal record.

Qualifications

Qualifications

  • 3-5 Years of experience in Web and API application Testing.
  • Experience in writing test cases using Zephyr, Jira, HP ALM or similar tools.
  • Experience in testing SAAS (Software as a Service) application is a plus.
  • Experience with CRM platforms such as Microsoft Dynamics is a plus.
  • Experience in debugging & Running the Test cases and analyzing the Test Results.
  • Experience in understanding Requirement Specifications and Design Documents.
  • Experience with all aspects of SDLC and STLC.
  • Experience with Functional & Non-Functional Testing & Regression Testing.
  • Experience in preparing Test Documentation (Test Scenarios, Test Plan, Test Findings, Test Data, Test Cases & Defect Reports).
  • Experience in defect management process using Jira, Bugzilla or similar tools.
  • Timely reporting of Status / Risks / Issues to client by direct interaction in Client Status Calls / Program Calls / Scrum calls and by status emails.
  • Experience in presenting Demos sessions to stake holders during different releases of UAT. Preparation of Daily Status Report (DSR), Weekly Status Report (WSR).
  • UI and API Automation Testing is a plus.
  • Experience in collaboration with on-shore and off-shore teams.
  • Possess excellent interpersonal, communication & analytical skills with demonstrated abilities in customer relationship management.

See more jobs at Mobica

Apply for this job

18d

QA Automation Engineer

MobicaWarsaw, Poland, Remote
apijavapython

Mobica is hiring a Remote QA Automation Engineer

Job Description

Our Customer is a leading global provider of cutting-edge payments technology solutions, dedicated to shaping the future of financial transactions worldwide. With a commitment to innovation and excellence, we connect consumers, businesses, financial institutions, and governments in over 200 countries and territories through our advanced processing networks.

We are currently looking for seasoned Quality Assurance and Automation engineer fluent in Python and Java frameworks. This job requires manual and automated application tests including API testing. Additional tasks will require work with scripting languages and PL/SQL databases.

This is a hybrid work opportunity, requiring attendance at the customer's office in Warsaw twice a week for team relationship-building purposes.

Due to the nature of our work in the financial market, candidates will be subject to detailed background screening including education, employment history, and criminal record.

Qualifications

Must Have

  • Automation with Python and Java frameworks skills
  • Manual Testing
  • Automated Testing
  • API testing experience
  • Familiarity with Scripting languages
  • Knowledge of PL/SQL database 

See more jobs at Mobica

Apply for this job

19d

Senior Software Engineer (Hybrid/Remote)

Oasis Africa Consulting LimitedJakande, Lekki, Nigeria, Remote
agileDesignhtml5scrumapiqagittypescriptAWSjavascriptbackendNode.js

Oasis Africa Consulting Limited is hiring a Remote Senior Software Engineer (Hybrid/Remote)

Job Description

 

Desired Abilities- Ability to:

Design, develop, and maintain high-quality, scalable, and secure software solutions using Node.js, TypeScript, and AWS technologies.

Collaborate with cross-functional teams, including product management, UX/UI design, and QA, to gather requirements, define specifications, and ensure the successful delivery of projects.

Architect and implement efficient, maintainable, and modular code in javascript and Typescript, adhering to best practices, coding standards, and established guidelines.

Optimise application performance by identifying bottlenecks, implementing solutions, and conducting regular code reviews.

Leverage AWS services and tools to design and implement cloud-native applications, ensuring optimal performance, security, and cost-effectiveness.

Participate in the entire software development lifecycle, from planning and design to deployment and maintenance, ensuring smooth project execution.

Stay up-to-date with industry trends, emerging technologies, and best practices in software engineering, particularly within the Node.js, TypeScript, and AWS ecosystems.

Troubleshoot, diagnose, and resolve software issues, providing timely and practical solutions to ensure minimal user disruption.

Collaborate with the other engineering team members to ensure smooth CI/CD pipelines, infrastructure management, and monitoring and alerting systems.

 

You could be an ideal match if you possess:

4+ years of professional experience in software development, focusing on web applications and backend services using JavaScript, TypeScript, and Node.js. You will need to have strong proficiency in JavaScript, TypeScript, and Node.js with a deep understanding of core concepts, asynchronous programming, and performance optimisation techniques.

2+ years of experience working with front-end frameworks, preferably Vue.js - and a solid understanding of HTML5, CSS3, and related web technologies - in building user-friendly and responsive web applications.

Familiarity with Agile development methodologies, such as Scrum or Kanban, and experience working in an Agile environment.

Some experience with NestJS, a progressive Node.js framework, and familiarity with its underlying principles, such as dependency injection and modularity, is a plus.

Knowledge of Domain-Driven Design (DDD) concepts and experience implementing DDD principles in software projects is valuable.

Familiarity with AWS services such as EC2, S3, Lambda, API Gateway, RDS, and Load balancers, and experience building scalable and secure cloud-based applications.

Knowledge of RESTful API design principles.

Experience with version control systems, preferably Git, and understanding of best code management and collaboration practices.

Proficiency in writing and maintaining unit, integration, and end-to-end tests using testing frameworks such as Jest, Mocha, or Jasmine.

Good knowledge of software development best practices, including design patterns, code modularity, and maintainability.

Strong problem-solving skills, with the ability to analyse complex issues, develop practical solutions, and adapt to changing requirements.

Excellent communication and collaboration skills, with the ability to work effectively in a team-oriented environment.

Qualifications

 

An engineering degree is not a prerequisite; instead, we highly value relevant experience in software development and a demonstrable portfolio of projects that highlight your skills.

See more jobs at Oasis Africa Consulting Limited

Apply for this job

Brightspeed is hiring a Remote Platform Program Manager, Enterprise & Wholesale

Job Description

Brightspeed has an exciting opportunity for a Platform Program Manager, Enterprise & Wholesale to join our rapidly growing team! As an individual contributor, you will be responsible for technical and non-technical program management, requirements gathering and verification, UAT, ORT, Go/No Go decisions, release support and program management lifecycle. You will work closely with IT and Business Operations teams to ensure alignment of processes and visions. The principal purpose of this role is to ensure consistent program management, on time / budget program release and effective communication for all programs assigned. This position will report to the Sr. Manager, Product & Platform Innovation – Governance. 

As a Platform Program Manager, Enterprise & Wholesale, your responsibilities will include: 

  • Lead the domain to develop and drive Enterprise & Wholesale TSA exit related strategies, requirements, ORT and implementation in alignment with business strategies 
  • Help develop a scalable and robust cross-domain system stack that caters to Enterprise and Wholesale (E&W) customers’ needs and business outcomes 
  • Define E&W product and platform excellence and enable operational efficiencies, through key analytics, enhancing product and service delivery, customer experiences 
  • Create cohesive cross domain Mass Markets (MM) and Enterprise & Wholesale (E&W) operational system support (OSS) and business system support (BSS) stacks that allow a seamless experience and internal cost efficiencies while maximizing system platform, network capabilities and customer experiences 
  • Support the Product and Platform Innovation team by managing assigned targeted efforts to completion 
  • Manage E2E program management life cycle for the Enterprise & Wholesale (E&W) platform stack 
  • Support application / platform UAT, ORT, JIRA management, release scheduling and system integration 
  • Develop and evaluate program plans to document scope, schedule, tasks, and risk management 
  • Ensure progress of assigned complex program/processes within budgetary and scheduling guidelines 
  • Creation and tracking of programs; escalate and track program issues; document progress and prepare status reports (metrics, summaries, etc.) to be communicated in both formal and informal settings 
  • Assist in ensuring that each program is executed with high quality and meets the measures of success 
  • Demonstrated exceptional presentation, interpersonal, relationship development, analytical, problem-solving and communication skills with the ability to present at the senior most level in the business 

Qualifications

WHAT IT TAKES TO CATCH OUR EYE: 

  • Bachelor’s degree in Project  / Program Management, Business, or related field 
  • 8+ years of experience managing cross-functional and/or cross team programs 
  • 7+ years of strong technical experience, preferably in telecommunications or software development, preferably with knowledge including but not limited to:  
  • Network technology configuration / implementation 
  • Ethernet 
  • Optical 
  • Product configuration / implementation  
  • WAN 
  • LAN 
  • Wi-Fi 
  • Managed Services 
  • Software development  
  • Portals 
  • API 
  • Orchestration 
  • Successful teamwork experience and demonstrated leadership abilities 
  • Self-directing and the ability to work with minimal supervision 
  • Must be able to read, understand and apply technical standards 
  • Ability to translate technical terms into plain language 
  • Ability to manage multiple projects / programs simultaneously and pivot quickly 
  • Excellent client-facing and internal communication skills 
  • Excellent PowerPoint & presentation skills  
  • Quick learner with excellent written & verbal communication and analytical problem-solving skills 
  • Solid organizational skills with attention to detail, context switching, and cope with tight deadlines 
  • Proficient in Microsoft Office applications 
  • Proficient in program planning and life cycle development tools 

BONUS POINTS FOR: 

  • Deep familiarity with fiber technology 
  • Certified Project / Program Management Professional (PMP)-PM or Project / Program Management Degree 
  • SmartSheets Knowledge 
  • JIRA Knowledge 

 

#LI-SS1

See more jobs at Brightspeed

Apply for this job

19d

Senior Full Stack Software Engineer - Cloud Applications

JitterbitSão Paulo, Brazil, Remote
DesignapijavadockerelasticsearchmysqltypescriptcsskuberneteslinuxangularAWSjavascriptNode.js

Jitterbit is hiring a Remote Senior Full Stack Software Engineer - Cloud Applications

Job Description

Jitterbit is seeking a Senior Full Stack Software Engineer to join our Cloud Applications team. Jitterbit is an iPaaS (Integration as a Service) and API Management platform who has been recognized in the leader quadrant of Gartner for five straight years. Our customers use our iPaaS and APIM platform to solve mission critical business problems. What is our challenge? To make it easy to integrate our customers’ systems. In order to do this, we need to build and create a SaaS offering that is reliable, stable, and scalable for our customers. Do you have the design, architecting, and code-writing capabilities to take on this challenge? And can succeed in a big way?

ABOUT THE TEAM

The engineering team at Jitterbit believes that the quality of our code reflects directly on us as professionals. We are relentless about crafting a product that is innovative and delivers a memorable user experience; an experience that is fast and robust. As a key engineer on our team, you will collaborate with other engineers, product management, and operations. Our culture is fun, fast-paced, performance-oriented, open, and collegial. We are constantly pushing the technology envelope to the edge! We are very distributed and our culture is set up to make all of us very effective working remotely. We believe in hiring talent where it exists.

ABOUT THE JOB

You will be helping us build, design, and architect awesome and new capabilities on our various Cloud Application products. We are looking for a senior full stack engineer. You will be working with Angular, TypeScript, Node.js, CSS3, Nginx, Tomcat, Kafka, Elasticsearch, MySQL, Linux, Docker, and Kubernetes; to name a few of the technologies we use in our Cloud Apps team. You will have full lifecycle responsibilities to create robust, scalable, and distributed systems that operate flawlessly 24x7x365. You will have an opportunity to learn new things. We’re always expanding into new areas, exploring new technologies and pushing the frontier of our platform.This is an exciting opportunity to work in a highly innovative environment with new technologies as we continue to extend our market leading position.

Qualifications

ABOUT YOU

You are an engineer who can turn ideas into extremely reliable and scalable designs. You code in such a way that other engineers find your code easy to comprehend, modify, and build upon. You believe in the power of Integration and APIs to transform how systems are integrated and how applications are built.

You will be successful in this role if you:

  • Enjoy helping and mentoring others around you as you grow and become a successful engineer and developer
  • Have excellent written and verbal communication skills
  • Are capable of working in a distributed team and able to excel in a remote culture
  • Are self-driven and able to work on key initiatives
  • Take pleasure in making things happen and listen to the input from peers
  • Are able to make data driven decisions
  • Are a believer in a best idea strategy regardless of where or who ideas come from

We are looking for:

  • 5-8+ years of experience in building large scale distributed applications.
  • Strong experience building multi-tenant SaaS applications
  • Strong problem-solving, debugging, and analytical skills with great attention to detail
  • Experience with Microservices and Cloud-based architectures/design patterns

Technical Skills and Experience:

  • Excellent JavaScript, CSS and HTML authoring skills.
  • Proficiency with Javascript, TypeScript, Java Node.js, or Go.
  • Familiar with application deployment via Docker and/or Kubernetes.
  • Hands-on experience with AWS services such as DynamoDB, S3, or CloudFront.
  • Bonus: Experience using DataDog APM and logging.
  • Bonus: Experience developing and releasing using CI/CD pipelines, such as GitHub Actions

See more jobs at Jitterbit

Apply for this job

20d

Full-Stack Software Engineering Intern

MozillaRemote Canada
sqlDesignapic++javascript

Mozilla is hiring a Remote Full-Stack Software Engineering Intern

Hiring Ranges:

Remote Toronto: CAD 30.00 per Hour.

To learn more about our Hiring Range System, please click thislink.

Why Mozilla?

Mozilla Corporation is the non-profit-backed technology company that has shaped the internet for the better over the last 25 years. We make pioneering brands like Firefox, the privacy-minded web browser, and Pocket, a service for keeping up with the best content online. 

Now, with more than225million people around the world using our products each month, we’re shaping the next 25 years of technology. Our work focuses on diverse areas including AI, social media, security and more. And we’re doing this while never losing our focus on our core mission – to make the internet better for everyone. 

The Mozilla Corporation is wholly owned by the non-profit 501(c) Mozilla Foundation. This means we aren’t beholden to any shareholders — only to our mission. Along with60,000+ volunteer contributors and collaborators all over the world, Mozillians design, build and distributeopen-sourcesoftware that enables people to enjoy the internet on their terms.

About this team and role:

Mozilla isn’t just a great place to work. It’s an experience you’ll carry with you throughout your career. As part of our internship program, you’ll have the opportunity to be mentored one-on-one by somebody brilliant, to impact the projects you’ll collaborate on, and to never be bored. Ever. From the passionate people you’ll learn from, to the chances you’ll have to make the Web a better place, your time with Mozilla will be unlike any other.

We are hiring for multiple Firefox Fullstack teams - each solving their own unique challenges to make the web better for everyone. More details about all hiring teams will be shared in the interviews. 

Below is a small snapshot of the work we do to give you an idea about some of the big things you could do at Mozilla.

What you'll do:

  • Work on one of the world’s largest and most important open source codebases - the Firefox Desktop Browser.
  • Work with a world class engineering organization solving problems at internet skill. Your work will positively affect hundreds of millions of folks worldwide.
  • Write code and tests, build prototypes, tackle problems with no clear solution, collaborate with other designers and engineers to make the web a better place.
  • Learn about a wide variety of problems and solutions across a large, mature codebase.
  • Work with driven, committed team members to bring the open web to people around the world.

What you'll bring:

  • You have experience with programming in JavaScript, HTML, and CSS. Knowledge of C/C++ and/or Rust is a plus.
  • Familiarity with SQL and relational databases is an asset.
  • Experience with API / Interface design 
  • You speak English fluently and enjoy conducting software engineering work in the open.
  • You are enrolled in a university and are available to come to our Toronto offices during regular working hours depending on your schedule.
  • You know how to identify a problem, come up with a logical solution, and use the knowledge to tackle similar problems in future.
  • You have an interest in and ability to work with a distributed team (which requires good asynchronous written communication skills as well as good verbal communication skills).
  • You are happy to provide and receive constructive feedback; when you see something that can be improved, you act on it.
  • You can build consensus on complex issues, through your empathy, internal credibility and visibility.
  • Unafraid of asking questions, and proposing new ideas if you think they will make a positive impact.
  • A love of helping your colleagues grow and get better at what they do.

We value a variety of voices within our team and at Mozilla. You don't need to check every box on this list to apply.

About Mozilla 

When you work at Mozilla, you give yourself a chance to make a difference in the lives of web users everywhere. And you give us a chance to make a difference in your life every single day. Join us to work on the web as the platform and help create more opportunity and innovation for everyone online.  We’re not a normal tech company. The things we create prioritize people and their privacy over profits. We exist to make the internet a healthier,  happier place for everyone

Commitment to diversity, equity and inclusion

Mozilla believes in the value of diverse creative practices and forms of knowledge, and knows diversity, equity and inclusion are crucial to and enrich the company’s core mission. We encourage applications from everyone, including members of all equity-seeking communities, such as (but not limited to) women, racialized and Indigenous persons, persons with disabilities, persons of all sexual orientations, gender identities and expressions.

We will ensure that qualified individuals with disabilities are provided reasonable accommodations to participate in the job application or interview process, to perform essential job functions, and to receive other benefits and privileges of employment, as appropriate. Please contact us at hiringaccommodation@mozilla.com to request accommodation.
 
We are an equal opportunity employer. We do not discriminate on the basis of race (including hairstyle and texture), religion (including religious grooming and dress practices), gender, gender identity, gender expression, color, national origin, pregnancy, ancestry, domestic partner status, disability, sexual orientation, age, genetic predisposition, medical condition, marital status, citizenship status, military or veteran status, or any other basis covered by applicable laws. Mozilla will not tolerate discrimination or harassment based on any of these characteristics or any other unlawful behavior, conduct, or purpose.
 
Req ID: R2337

See more jobs at Mozilla

Apply for this job

20d

Full-Stack Software Engineer (PHP/ReactJS)

LoyaltekBrussels, BR Remote
5 years of experiencelaravelDesignapipostgresqlmysqlAWSjavascriptbackendfrontendPHP

Loyaltek is hiring a Remote Full-Stack Software Engineer (PHP/ReactJS)

Full-Stack Software Engineer (PHP/ReactJS)

Location: Brussels (Hybrid or Remote) Status: Freelancer Starting: ASAP

Giftify is a FinTech/MarTech scale-up leader in turn-key Gift Card solutions for Shopping Centres and retailers across Europe. Our goal is to become the world leader in our industry.

Through our Gift Card products, our passion is to bring efficient and innovative solutions to allow Shopping Centres and Retail Parks to raise and revolutionize their marketing strategy 'one gift card at a time'.

Your mission, should you choose to accept it

We are seeking a passionate Full-Stack Software Engineer to join our team. The ideal candidate will have a strong background in translating complex problems into simple and reliable code. As a key member of our team, you will be responsible for analyzing and implementing new features within our application from both frontend and backend perspectives. This includes areas such as payment processing, API endpoints, tokenization, virtual cards, administration tools, graphics, and reports.

Responsibilities

  • Develop and implement new features across frontend and backend systems.
  • Collaborate with the team to ensure high-quality code and efficient performance.
  • Contribute to the continuous improvement of development processes and best practices.
  • Assist in bug fixing and troubleshooting to maintain system reliability.
  • Share knowledge and mentor colleagues to enhance team capabilities.

Mandatory hard skills

  • Minimum 5 years of experience in a similar role.
  • Proficiency in PHP 8.2 with modern features such as types and annotations.
  • Strong expertise in Laravel 10, including cache, queues, Eloquent ORM, and Laravel Passport.
  • Mastery of React, JavaScript, and TypeScript.
  • Knowledge of ReactNative is a plus.

The 5-legged goat (or assets)

  • Experience with testing strategies such as unit testing, integration testing, and TDD.
  • Proficiency in RESTful API design using tools like OpenAPI and Postman.
  • Familiarity with relational databases like MySQL or PostgreSQL, including optimization and design.
  • Collaborative development using pull requests.
  • Familiarity with CI/CD, DevOps, IaC, AWS is advantageous.

Soft skills

  • Proficient written and oral English communication (level B2 or above).
  • Strong team player comfortable with pair programming.
  • Ownership and accountability for work delivered.
  • Ability to share knowledge and expertise with the team.

Even if you're not a Superhero

Don't meet every requirement? Don't hesitate to apply! We value diverse experiences and perspectives, and we're committed to adding new talent to our team.

Recruitment process

  • Stage 1: Initial meeting with our recruiter to assess suitability.
  • Stage 2: Technical exercise to demonstrate skills.
  • Stage 3: Presentation of solution to Technical Director for further discussion and alignment.

Join us in revolutionizing the Gift Card industry and shaping the future of marketing strategies. Apply now and be part of our exciting journey!

See more jobs at Loyaltek

Apply for this job

20d

SDET/Test Automation QA Engineer

SonderMindDenver, CO or Remote
agilepostgresscrumapiqagitrubyc++elasticsearchtypescriptangularjenkinsAWSjavascript

SonderMind is hiring a Remote SDET/Test Automation QA Engineer

About SonderMind

At SonderMind, we know that therapy works. SonderMind provides accessible, personalized mental healthcare that produces high-quality outcomes for patients. SonderMind's individualized approach to care starts with using innovative technology to help people not just find a therapist, but find the right, in-network therapist for them, should they choose to use their insurance. From there, SonderMind's clinicians are committed to delivering best-in-class care to all patients by focusing on high-quality clinical outcomes. To enable our clinicians to thrive, SonderMind defines care expectations while providing tools such as clinical note-taking, secure telehealth capabilities, outcome measurement, messaging, and direct booking.

To follow the latest SonderMind news, get to know our clients, and learn about what it’s like to work at SonderMind, you can follow us on InstagramLinkedin, and Twitter

About the Role

As an SDET/Test Automation QA Engineer, you will have a passion for successfully developing robust and scalable testing frameworks to continuously improve quality, reduce cycle time, and bake efficiency into our development and testing processes. You will work closely with Product and Support teams to consistently advocate for end-users by ensuring the SonderMind platform is stable and meets the functional requirements. You strive for quality releases and exceeding customer expectations.    

Essential Functions 

  • Create and maintain automated and manual test cases
  • Assist with any manual testing needs on the team
  • Participate and have input on QA direction discussions; own the QA processes on the team 
  • Accountable for testing all stories coming through the team
  • Work with other SDET’s and Manual testers to ensure cross team projects are thoroughly tested
  • Work closely with engineers  to understand the underlying architecture in the code to create more robust tests.

What does success look like?

  • Quickly integrates into the team and becomes familiar with tools, process, and culture of existing software development and testing life cycles. Tests while leveraging existing scripts and adds to and/or makes recommendations for improvement.
  • Start build and implementation of go-forward test automation framework(s).
  • Well versed in our go-forward automated testing strategy. Fully understands system architecture, business functionality and technical dependencies. The test automation framework is stable, reusable, and positively growing code coverage.

Who you are?

  • 4+ years of software test development experience with proficiency in Javascript, Typescript, or similar 
  • Experience in Unix scripting or equivalent command line tools 
  • Experience with designing and developing full stack test automation ( Protractor, Cypress, etc)  
  • Proficiency with continuous integration and continuous deployment pipelines and tools  (Gitlab CI, CircleCI, Jenkins)
  • Testing and automating RESTful API service calls via tools such as Postman, Bruno, or similar
  • Ability to lead creation and maintenance of advanced suites of automated scripts for the full stack
  • Source control, Git experience
  • Experience in communicating quality reporting and metrics of test execution results, including use in visibility dashboards
  • Strong understanding of SDLC processes specifically agile scrum methodology

Preferred Experience 

  • Test case management systems, including creating integrations with one 
  • Load & Performance Test Engineering
  • Demonstrated experience in designing automation creating modular test scripts for reuse
  • Coding or working familiarity with any of the following technologies: Angular, AWS Deployment , ElasticSearch, Unit testing RSpec, Jasmine or similar experience, Ruby on Rails, Postgres, Redis

Our Benefits 

The anticipated salary rate for this role is between $114,000-130,000 per year.

As a leader in redesigning behavioral health, we are walking the walk with our employee benefits. We want the experience of working at SonderMind to accelerate people’s careers and enrich their lives, so we focus on meeting SonderMinders wherever they are and supporting them in all facets of their life and work.

Our benefits include:

  • A commitment to fostering flexible hybrid work
  • A generous PTO policy 
  • Therapy coverage benefits to ensure our employees have access to the care they need
  • Competitive Medical, Dental, and Vision coverage with plans to meet every need, including HSA and FSA options
  • Employer-paid disability & AD&D to cover life's unexpected events. Not only that, we also cover the difference in salary for up to eight (8) weeks of short-term disability leave
  • Eight weeks of paid Parental Leave  (if the parent also qualifies for STD, this benefit is in addition)
  • 401K retirement plan with 100% matching on up to 4% of base salary

Application Deadline

This position will be an ongoing recruitment process and will be open until filled.

 

Equal Opportunity 
SonderMind does not discriminate in employment opportunities or practices based on race, color, creed, sex, gender, gender identity or expression, pregnancy, childbirth or related medical conditions, religion, veteran and military status, marital status, registered domestic partner status, age, national origin or ancestry, physical or mental disability, medical condition (including genetic information or characteristics), sexual orientation, or any other characteristic protected by applicable federal, state, or local laws.

Apply for this job

20d

Technical Customer Support Analyst - Dayshift

ExperianHeredia, Costa Rica, Remote
uiapi

Experian is hiring a Remote Technical Customer Support Analyst - Dayshift

Job Description

Experian Data Quality is a recognized industry leader of data quality and data quality management solutions. Our comprehensive solutions validate, standardize, enrich, profile, and monitor your customer data so that it is fit for purpose. With flexible SaaS and on-premise deployment models, our software is customizable to every environment and any vision. In this role, you will have the opportunity to support our clients, allocated all around the globe, contemplating a variety of industries. You will have the opportunity to become an expert in EDQ's software portfolio, and to provide a world-class support to our clients, enhancing a great experience and ensuring they value our company in a very competitive industry.

Role Summary

• Providing remote, software technical support for Experian EDQ clients. Our solutions include data cleansing, validation enrichment and profiling.

• Promptly assist in solving clients’ issues through various channels, including email, phone, and ticketing systems.

• Diagnose and troubleshoot technical issues related to API, data processing, and application functionality.

• Collaborate with internal teams, including product development, Level 2 and Level 3 engineering team, and account management, to resolve complex technical issues and escalate when necessary.

• Document interactions with costumers, including troubleshooting steps, solutions provided, current action owner and follow-up plans, in a clear and concise manner.

• Assist in the creation and maintenance of knowledge base articles through the Knowledge Centered Service methodology.

• Stay informed about product updates, new features, and industry trends related to data quality management and API technologies.

     

    Qualifications

     

    • 1-3 Years of Desktop Support, Help-Desk, or IT related support
    • BA degree or equivalent experience desired
    • English Level B2

    Knowledge, Skills and Experience

    • Familiarity with SOAP UI, SFTP, JSON, REST APIs and SaaS
    • IT/Networking general knowledge
    • CLI knowledge
    • Familiarity with SOAP UI, SFTP, JSON, REST APIs and SaaS
    • CLI knowledge
    • Being passionate about the data world

    See more jobs at Experian

    Apply for this job

    TIS is hiring a Remote (Senior) Security Engineer (Monitoring, Incident Response)

    Job Description

    • Hybrid role in a small dynamic team, with direct access to stakeholders and possibilities to learn about a large array of topics, in a company with strong cybersecurity needs. The position helps secure all assets of the company – from workstations to Office 365, AWS, servers, containers, source code, continuous deployment systems, etc.;
    • Support our efforts to improve visibility over our assets, their security level, their vulnerabilities. Help us find out our blind spots and how to solve them;
    • Improve monitoring tools and rules based on your understanding of attack vectors that could impact the company;
    • Monitor security alerts and incidents, respond promptly to mitigate potential threats. Investigate security incidents, document findings and recommend improvements. Help us improve processes and grow our teams so that other team members can be autonomous in your absence;
    • Reporting directly to the CISO.

    Qualifications

    • Must-have: able to present cybersecurity positively as an enabler to business rather than a constraint; able to find the best agreement suiting all stakeholders while fulfilling security objectives;
    • Ability to work on multiple topics and respond to enquiries without necessarily being an expert of all topics;
    • Experience in incident response and threat detection, familiarity with SIEM (Security Information and Event Management) tools;
    • Experience in scripting, like writing PowerShell Scripts based on the Microsoft Graph API to export information that could be used to detect attacks and misconfigurations;
    • Strong analytical and problem-solving skills, ability to prioritize and manage your own small projects from end to end;
    • Knowledge of common cyber threats and attack vectors;
    • Cybersecurity certifications would be beneficial.

    We strongly encourage applications from individuals of all backgrounds, to join our international dynamic team. We believe in fostering a diverse and inclusive workplace where everyone's perspectives are valued and respected.

    See more jobs at TIS

    Apply for this job

    20d

    Implementation Team Manager

    CloudflareRemote Portugal
    Designapic++pythonjavascript

    Cloudflare is hiring a Remote Implementation Team Manager

    About Us

    At Cloudflare, we have our eyes set on an ambitious goal: to help build a better Internet. Today the company runs one of the world’s largest networks that powers approximately 25 million Internet properties, for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

    We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

    Available Locations: Lisbon or Remote Portugal

    Implementation Team Manager, Professional Services

     

    Overview:

    We are seeking a highly motivated and experienced Implementation Team Manager for Professional Services who will be responsible for the technical delivery of consultative and hands-on-keyboard implementation and migration services for enterprise customers. 

     

    You are the team enabler, point of reference and coach. You will grow and develop your team and make sure work loads are equally distributed within the team. You are personable and can provide constructive feedback when necessary. You will help escalate and identify issues quickly and efficiently and you will work with the other team leads and the global head to ensure proper regional & cross-regional coordination. You have a solid technical background along with leadership and management skills. 

     

    Ultimately, you are passionate about technology, have the ability to explain complex technical concepts in easy-to-understand terms and you like coaching and teaching. You are naturally curious and an avid builder who is not afraid to get your hands dirty.

     

    Requirements:

    Demonstrable experience in:

    • Professional services delivery. 
    • Coaching, leadership skills or team management.
    • Owning and solving escalations, team issues or other management related scenarios.
    • Building processes, leveraging tools and Agile methodologies for operational excellence.
    • Deep understanding of how the Internet works. 
    • Layers and protocols of the OSI model, such as TCP/IP, UDP, TLS, DNS, HTTP.
    • Reverse and forward proxies and the application of both.
    • IPv4/6, VPNs, router and L3/L4 and next gen firewall configuration, SDN and overall IT networking related best practices.
    • Demonstrated experience with BGP (network architecture, design & implementation), tunneling technologies such as GRE & IPSec, MPLS, SD-WAN, NetFlow and/or sFlow.
    • 5+ years in a customer facing position. 
    • Ability to work with all levels of an organization (both internally and externally) with experience of both working cross-functionally and geographically. 
    • Strong interpersonal communication (verbal and written) and organizational skills.
    • Highly motivated, driven and passionate about technology and customer success.
    • Anticipates needs, innovates, multi-tasks and excels in a fast-paced environment.
    • Experience with Salesforce and the Atlassian Suite (Confluence/JIRA). 
    • The work will be performed in English. Fluency in a second European language is a must.

     

    Inter-Team Goals

    • Cultivate cross team/office/region/global coordination, keep us all connected as one team.
    • Facilitate knowledge transfer between teams.  Ensure the team learns from the great ideas of single team members.  Ensure mistakes are not repeated within the team.
    • Develop strong relationships outside of the Professional Services organization to aid in escalation of issues (product/support/engineering/special projects/marketing/legal/etc).

     

    Intra-Team Goals

    • Keep the pulse of the team: who is happy, productive, performing. Know each member’s strengths and how they would each like to develop.
    • Exemplify and cultivate positive culture traits.
    • Provide support and confidence to team members.
    • Cultivate a very open communication and diverse environment. Criticism is welcome and appreciated.
    • Maintain a culture of independence amongst team members whilst offering advice when appropriate.

     

    Personal Goals

    • Maintain trust and respect from the team.
    • Ability to handle any call from any customer.

     

    Responsibilities:

    • Project portfolio delivery, risk management, reporting, cost management, time management and stakeholder management. 
    • Workload Management.
    • Conduct 1:1’s with team members.
    • Act as a point of escalation for team issues, escalate issues that can’t be solved within the team.
    • Recruit, interview, and onboard new team members.
    • Report on individual IM’s strengths and weaknesses. Build and execute development plans.
    • Continuously improve the operating model: people, processes and tools evolve for success.

    What Makes Cloudflare Special?

    We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

    Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

    Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

    Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

    1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

    Sound like something you’d like to be a part of? We’d love to hear from you!

    This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

    Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

    Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

    See more jobs at Cloudflare

    Apply for this job

    20d

    Systems Engineer - Access

    CloudflareRemote US
    postgresapic++elasticsearchtypescriptkubernetesfrontend

    Cloudflare is hiring a Remote Systems Engineer - Access

    About Us

    At Cloudflare, we are on a mission to help build a better Internet. Today the company runs one of the world’s largest networks that powers millions of websites and other Internet properties for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

    We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

    Available Locations:Hybrid - Austin orRemote - US

    What you’ll do

    In this role you’ll help us build Access, a Zero Trust platform that secures self-hosted and SaaS applications by aggregating sources of user identity and trust, and enforcing rules on every request or login. As an engineer on the Access team, you will focus on our high-performance global edge network services that build those identities and enforce those rules. You will also contribute to the control plane API’s that configure those edge services. You will be joining a global team of bright, hard-working, and supportive engineers who really care about their craft.

    Technologies we use:

    Access core edge services are written in Typescript and Lua and are deployed globally to 200+ data centers 

    • Our REST API is written in Go, runs on Kubernetes, and uses Postgres as a data store.
    • Our frontend is written in Typescript and React.
    • For service monitoring we use Prometheus and Grafana.
    • For service logging we use Elasticsearch and Kibana.
    • For product analytics we use Clickhouse and BigQuery. 

    Examples of desirable skills, knowledge and experience:

    • Programming experience in Go and Typescript/Javascript. 
    • Basic understanding of software security and encryption
    • Experience in designing and implementing secure and highly-available distributed systems
    • Willingness, curiosity, and enthusiasm to learn new programming languages, technologies and systems
    • Strong interpersonal and communication skills. Caring and empathy are coveted traits here!

    Compensation

    Compensation may be adjusted depending on work location.

    • For Colorado-based hires: Estimated annual salary of $115,000 - $141,000
    • For New York City, Washington, and California (excluding Bay Area) based hires: Estimated annual salary of $133,000 - $163,000
    • For Bay Area-based hires: Estimated annual salary of $140,000 - $172,000

    Equity

    This role is eligible to participate in Cloudflare’s equity plan.

    Benefits

    Cloudflare offers a complete package of benefits and programs to support you and your family.  Our benefits programs can help you pay health care expenses, support caregiving, build capital for the future and make life a little easier and fun!  The below is a description of our benefits for employees in the United States, and benefits may vary for employees based outside the U.S.

    Health & Welfare Benefits

    • Medical/Rx Insurance
    • Dental Insurance
    • Vision Insurance
    • Flexible Spending Accounts
    • Commuter Spending Accounts
    • Fertility & Family Forming Benefits
    • On-demand mental health support and Employee Assistance Program
    • Global Travel Medical Insurance

    Financial Benefits

    • Short and Long Term Disability Insurance
    • Life & Accident Insurance
    • 401(k) Retirement Savings Plan
    • Employee Stock Participation Plan

    Time Off

    • Flexible paid time off covering vacation and sick leave
    • Leave programs, including parental, pregnancy health, medical, and bereavement leave

     

    What Makes Cloudflare Special?

    We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

    Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

    Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

    Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

    1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

    Sound like something you’d like to be a part of? We’d love to hear from you!

    This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

    Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

    Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

    See more jobs at Cloudflare

    Apply for this job

    20d

    SAP S/4HANA Solution Architect

    agilesalesforceDesignapi

    Sourcefit Philippines is hiring a Remote SAP S/4HANA Solution Architect

    Position Summary:

    Our client is embarking on a large digital transformation to update its current legacy SAP environments to a single consolidated SAP S/4HANA instance. This requires an experienced SAP S/4HANA Solution Architect to be responsible for the design, technical leadership, and direction of the project.

    The Solution Architect will be responsible for taking ownership for defining the future state application architecture, develop architectural designs and oversee the delivery of the client’s SAP S/4HANA workstream. Deliver new digital concepts for products and services that meet the client’s strategic goals to deliver a world-class customer experience and a digitally engaged workforce, working with internal colleagues and external partners. Delivering high-quality and secure solutions at pace across multiple business divisions. A deep understanding of SAP S/4HANA modules and capabilities is critical, with strong technical expertise, and a proven track record of successful project delivery.

    Job Details:

    • Work from home.
    • Monday to Friday | 3 PM to 12 AM Manila time
    • *Following UK Holidays

    Responsibilities:

    • Design end-to-end SAP S/4HANA solutions that align with the business objectives of our clients. This involves analysing business processes, identifying opportunities for process optimization, and architecting scalable and efficient solutions.
    • Provide technical leadership throughout the project lifecycle, from solution design and development to deployment and support. Collaborate with cross-functional teams including developers, consultants, and product analysts to ensure the successful implementation of SAP S/4HANA solution.
    • Configure SAP S/4HANA modules to meet business requirements. This includes designing and implementing business processes, data models, and user interfaces using SAP Fiori. Design and implement integrations between Salesforce and other systems, both internal and external. This involves evaluating integration requirements, selecting appropriate integration patterns, and overseeing the development and testing of integrations.
    • Design and implement integrations between SAP S/4HANA and other systems, both within the SAP ecosystem and with external systems. This involves evaluating integration requirements, selecting appropriate integration technologies, and overseeing the development and testing of integrations. Strong knowledge of API design would be a benefit.
    • Define data migration strategies and oversee the migration of data from legacy systems to SAP S/4HANA. Ensure data integrity, quality, and consistency throughout the migration process.
    • Ensure architectural designs are implemented and governed in line with the company’s principles and patterns.
    • Capture and define low-level design (LLD) documentation, producing LLDs for each epic, capturing detail prior to starting a sprint. Ensuring all planned work meets our definition of ‘ready’ by ensuring planned sprint items have a viable delivery solution added to each committed user story.
    • Work alongside the Digital App Managers and the Digital Development Director to size or validate planned sprint items to ensure effective sprint planning and delivery is occurring.
    • Support and attend backlog refinement and all sprint ceremonies, including planning sessions, to ensure only ‘ready’ items are included in sprint targets.
    • Provide summaries to the delivery teams, explaining proposed solutions for each planned sprint. If work is not ready to address the gaps or remove work from sprint planning
    • Act as a key contact for technical or solution questions and be able to succinctly explain needs to the Enterprise Architect or Director of Digital Development
    • Identify opportunities for improvement across the Digital portfolio and find creative ways to develop an entrepreneurial culture.

    Qualifications:

    • Deep understanding of SAP S/4HANA modules and capabilities, including Finance, Supply Chain Management, Manufacturing, and Human Resources.
    • Strong technical expertise in SAP S/4HANA configuration, customization, and development using SAP Fiori, ABAP, and SAP HANA.
    • Experience with SAP integration technologies such as SAP Process Integration (PI/PO), SAP Cloud Platform Integration (CPI), and SAP Data Services.
    • Relevant SAP certifications such as SAP Certified Application Associate - SAP S/4HANA or SAP Certified Technology Associate - SAP S/4HANA are highly desirable.
    • Significant experience in defining and creating new solutions and delivering enterprise-grade digital services in a national or international multi-site, preferably retail, business
    • Extensive experience and understanding of agile methods with the ability to demonstrate continuous improvement and delivery of regular high-quality deliverables.
    • Ability to convert information into tangible digital assets that can be explained to others.
    • A deep understanding of service integration and an ability to rapidly translate and document integration requirements.
    • Experience in working collaboratively, including influencing, and negotiating with suppliers, stakeholders and partners to define and deliver digital roadmaps.
    • A deep understanding of digital technology and eBusiness trends, including a strong understanding of integration patterns, and microservices architecture.
    • Attention to detail is essential, with the skills to be able to abstract ideas and requirements as needed with extensive experience in writing, reviewing, and defining user stories.
    • Strong understanding of enterprise design patterns
    • A good understanding of cloud technologies and micro-service architectures with familiarity with service integration
    • A good understanding of ERP and master data management.
    • Understanding why security & privacy-by-design are central to the way new digital deliveries are shaped

    See more jobs at Sourcefit Philippines

    Apply for this job

    20d

    Engineering Manager - Remote

    agileB2BDesignmobileuiscrumapigit

    VALONDE COMPANY S.A. is hiring a Remote Engineering Manager - Remote

    ENGINEERING MANAGER - REMOTE - Toolbox OTT - Career Page

    See more jobs at VALONDE COMPANY S.A.

    Apply for this job

    21d

    Software engineer in cyber security - Mobile bot protection, Rust

    ImpervaHybrid Remote, Stockholm, Sweden
    terraformmobileapiiosandroidAWS

    Imperva is hiring a Remote Software engineer in cyber security - Mobile bot protection, Rust

    Software engineer in cyber security - Mobile bot protection, Rust

     

    About the product

     

    Advanced Bot Protection defends mission-critical websites, mobile apps, and APIs from automated threats - bad bots - without affecting the flow of business-critical traffic.
     
    Bad bots are purpose-built to attack organizations’ websites and mobile apps through web scraping, account takeover, transaction fraud, denial of service, competitive data mining, unauthorized vulnerability scans, spam, click fraud, and web and mobile API abuse.
     
    A unique security concern, the bot problem is focused on abuse of business functionality rather than finding and exploiting vulnerabilities.

    About the team

     

    We are a team of programmers based in central Stockholm responsible for developing real-time bot detection software, data processing pipelines, and customer-facing tools. Our team works according to modern development practices and our main language is Rust. We also have frontends, and browser/mobile SDKs for Android and iOS. We operate a global infrastructure and deploy daily and we work closely with data scientists and cybersecurity threat researchers.

    About you

     

    We are now looking for a person who wants to help us in strengthening our defenses against bad bots. You have an analytical and creative mindset and can approach problems from new angles. Most likely, you enjoy exploring new technologies and use them to your advantage, rather than being heavily specialized in a few areas.
    Expectations:
    • Minimum of 5 years experience developing and delivering distributed systems
    • Solid experience and understanding of mobile devices and SDKs
    • Strong interest in Rust
    • Experience in Cloud environment, preferably AWS
    Advantage:
    • Experience with web browser technologies
    • Experience with Terraform or similar
    • Experience with cybersecurity
    Responsibilities Mobile Bot Protection:
    • Develop and maintain mobile SDK for Android and iOS
    • Support customers with SDK integration and related issues
    • Research and implement new capabilities for Mobile Bot Protection

    About the company

     

    Imperva is an analyst-recognized, cybersecurity leader—championing the fight to secure data and applications wherever they reside. Once deployed, our solutions proactively identify, evaluate, and eliminate current and emerging threats, so you never have to choose between innovating for your customers and protecting what matters most. Imperva—Protect the pulse of your business
    Check out all of our career opportunities atwww.imperva.com/Company/Careers
    Legal Notice:
    Imperva is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, ancestry, pregnancy, age, sexual orientation, gender identity, marital status, protected veteran status, medical condition or disability, or any other characteristic protected by law. 
     
     

    See more jobs at Imperva

    Apply for this job

    21d

    Senior Infrastructure Engineer (Core)

    Telny(Remote) LATAM
    terraformDesignansibleapikuberneteslinuxpython

    Telny is hiring a Remote Senior Infrastructure Engineer (Core)

    About Telnyx

    Telnyx is an industry leader that's not just imagining the future of global connectivity—we're building it. From architecting and amplifying the reach of aprivate, global, multi-cloud IP network, to bringinghyperlocal edgetechnology right to your fingertips through intuitive APIs, we're shaping a new era of seamless interconnection between people, devices, and applications.

    We're driven by a desire to transform and modernize what's antiquated, automate the manual, and solve real-world problems through innovative connectivity solutions. As a testament to our success, we're proud to stand as a financially stable and profitable company. Our robust profitability allows us not only to invest in pioneering technologies but also to foster an environment of continuous learning and growth for our team.

    Our collective vision is a world where borderless connectivity fuels limitless innovation. By joining us, you can be part of laying the foundations for this interconnected future. We're currently seeking passionate individuals who are excited about the opportunity to contribute to an industry-shaping company while growing their own skills and careers.

    Are you passionate about building and scaling next-generation infrastructure? Do you thrive in a fast-paced environment where you can make a real impact? If so, then join our rockstar infrastructure team at Telnyx! We're building a cutting-edge, cloud-agnostic platform that spans continents and empowers our product teams to achieve amazing things.

    In this role, you'll not only collaborate with a talented team to deploy and maintain our infrastructure provisioning automation, but you'll also have the opportunity to:

    • Shape the future: We value your input! You'll collaborate with engineering teams to identify pain points and continuously improve our internal architecture for scalability and resilience.
    • Become a cloud native expert: Deepen your knowledge of service mesh, container technologies, and CI/CD pipelines.
    • Level up your skills: Learn about every technology stack Telnyx uses and become a well-rounded infrastructure engineer.

    You’d Be A Good Fit If You Have

    • 3+ years of professional software development and infrastructure operations experience
    • Strong experience in Kubernetes management and applications development. Better if you have managed on-premises clusters.
    • Proficiency on at least one programming language (Python, Golang, etc). 
    • Expert knowledge of at least one configuration language (Ansible, Puppet, Terraform, etc).
    • Experienced in shaping and improving CI/CD infrastructure design, architecture, and implementation support.
    • General knowledge of container technologies, linux networking and operating systems.
    • Candidates MUST have a good understanding of basic networking protocols like (DNS, HTTP, TLS). Knowing other networking protocols like BGP is a plus.
    • Knowledge of service discovery and service mesh architectures is a big plus.

    Growth Opportunities: 

    • Act as a strength multiplier to product engineering efforts. 
    • Learn about every technology stack used at Telnyx.
    • Work at the intersection of the social and the technical, with growth opportunities in both.

    Bring Your Authentic Self to Telnyx

    Telnyx is committed to building a team full of diverse perspectives, various backgrounds and different minds. We believe diversity drives innovation. We are committed to building a culture where difference is valued and creating avenues of equity for underserved groups. While we are still a work in progress, we are actively seeking folks who are  passionate about building a place of belonging for everyone. 

    We're looking for people with passion, grit, and integrity. We believe in transparency, proactivity, and mutual respect. We provide the high-grade tools that help you do your best work, and keep up the collaborative habits that help everyone stay in the loop. No matter where you're based or which team you’re on, you’re plugged in, supported, and helping to shape the future of communications. 

    You're encouraged to apply even if your experience doesn't precisely match the job description. Your skills and passion will stand out—and set you apart—especially if your career has taken some extraordinary twists and turns. At Telnyx, we welcome diverse perspectives, rigorous thinkers and assumption challengers. Are you ready to join us?

    See more jobs at Telny

    Apply for this job