api Remote Jobs

678 Results

8d

QA Automation Engineer (SDET II)

Live PersonHyderabad, Telangana, India (Remote)
Designapiqajavajenkinspythonjavascript

Live Person is hiring a Remote QA Automation Engineer (SDET II)

LivePerson (NASDAQ: LPSN) is the global leader in enterprise conversations. Hundreds of the world’s leading brands — including HSBC, Chipotle, and Virgin Media — use our award-winning Conversational Cloud platform to connect with millions of consumers. We power nearly a billion conversational interactions every month, providing a uniquely rich data set and safety tools to unlock the power of Conversational AI for better customer experiences.

At LivePerson, we foster an inclusive workplace culture that encourages meaningful connection, collaboration, and innovation. Everyone is invited to ask questions, actively seek new ways to achieve success, nd reach their full potential. We are continually looking for ways to improve our products and make things better. This means spotting opportunities, solving ambiguities, and seeking effective solutions to the problems our customers care about.

Overview
Over the next three years, our goal is to transform the 268 billion analogue phone calls between a brand and it’s consumers to digital on the LiveEngage platform. By doing this, we enable consumers to get back time and experience a more connected relationship with the brand in which sales, service, marketing, branches, stores, and contact center's become a unified experience.

The successful candidate has an opportunity to join a highly outstanding team within a fast-paced and successful organization.

You Will

We are looking for a Quality Assurance (QA) engineer to develop and execute exploratory and automated tests to ensure product quality. QA engineer responsibilities include understanding system requirements, designing and implementing tests and in some cases debugging and defining corrective actions. You will also review system requirements and track quality assurance metrics (e.g. defect densities and open defect counts.)

  • Review requirements, specifications and technical design documents to provide timely and meaningful feedback
  • Create detailed, comprehensive and well-structured test plans and test cases
  • Create System, Resiliency and Performance verification test plans and test cases
  • Estimate, prioritize, plan and coordinate testing activities
  • Design, develop and execute automation scripts using open source tools
  • Identify, record, document thoroughly and track bugs
  • Perform thorough regression testing when bugs are resolved
  • Develop and apply testing processes for new and existing products to meet client needs
  • Liaise with internal teams (e.g. developers and product managers) to identify system requirements
  • Monitor debugging process results
  • Investigate the causes of non-conforming software and train users to implement solutions
  • Track quality assurance metrics, like defect densities and open defect counts
  • Stay up-to-date with new testing tools and test strategies

You Have

  • 5+ Years of experience
  • BS/MS degree in Computer Science, Engineering or a related subject
  • Proven work experience in software quality assurance
  • Strong knowledge of software QA methodologies, tools and processes
  • Experience testing SPA and REST based API’s in microservices based software
  • Experience in writing clear, concise and comprehensive test plans and test cases
  • Strong programming skills in one of the languages such as: Java, Python, Go, Groovy, Proven, Javascript
  • Experience is QA automation tools, frameworks and libraries
  • Hands-on experience with both white box and black box testing
  • Hands-on experience with automated testing tools and libraries
  • Experience working in an Agile/Scrum development process
  • Experience with performance, resiliency and/or security testing is a must
  • Experience testing high scalable distributed systems is a must
  • Experience working with Chaos Monkey, JMeter  is a plus
  • Knowledge of CI/CD and experience working with Jenkins or similar tools.

Benefits

  • Health: Medical, Dental, and Vision
  • Time away: Vacation and holidays
  • Development: Generous tuition reimbursement and access to internal professional development resources.
  • Equal opportunity employer

Why You’ll Love Working Here

As leaders in enterprise customer conversations, we celebrate diversity, empowering our team to forge impactful conversations globally. LivePerson is a place where uniqueness is embraced, growth is constant, and everyone is empowered to create their own success. And, we're very proud to have earned recognition from Fast Company, Newsweek, and BuiltIn for being a top innovative, beloved, and remote-friendly workplace.

Belonging At LivePerson
We are proud to be an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to age, ancestry, color, family or medical care leave, gender identity or expression, genetic information, marital status, medical condition, national origin, physical or mental disability, protected veteran status, race, religion, sex (including pregnancy), sexual orientation, or any other characteristic protected by applicable laws, regulations and ordinances. We also consider qualified applicants with criminal histories, consistent with applicable federal, state, and local law.

We are committed to the accessibility needs of applicants and employees. We provide reasonable accommodations to job applicants with physical or mental disabilities. Applicants with a disability who require reasonable accommodation for any part of the application or hiring process should inform their recruiting contact upon initial connection.

Apply for this job

8d

Product Manager - Digital

ecobeeRemote in Canada
agileDesignapiUX

ecobee is hiring a Remote Product Manager - Digital

Hi, we are ecobee. 

ecobee introduced the world’s first smart Wi-Fi thermostat to help millions of consumers save money, conserve energy, and bring home automation into their lives. That was just the beginning. We continue our pursuit to create technology that brings peace of mind into the home and allows people to focus on the moments that matter most. We take pride in making a meaningful difference to the environment, all while being part of the exciting, connected home revolution. 

In 2021, ecobee became a subsidiary of Generac Power Systems.Generac introduced the first affordable backup generator and later created the category of automatic home standby generator. The company is committed to sustainable, cleaner energy products poised to revolutionize the 21st century electrical grid. Together,we take pride in making a meaningful difference to the environment.

Why we love to do what we do: 

We’re helping build the world of tomorrow with solutions that improve everyday life while making a positive impact on the planet. Our products and services work in harmony to provide comfort, efficiency, and peace of mind for millions of homes and businesses. While we’re proud of what we’ve done so far, there’s still a lot we can do—and you can be part of it.  

Join our extraordinary team. 

We're a rapidly growing global tech company headquartered in Canada, in the heart of downtown Toronto, with a satellite office in Leeds, UK (and remote ecopeeps in the US). We get to work with some of North America and UK's leading professionals. Our colleagues are proud to bring their authentic selves to work, confident that what we do is grounded in a greater purpose. We’re always looking for curious, talented, and passionate people to join our team.

Who’ll You Be Joining: 

We’relooking for a Product Manager(Technical)to join ourtight-knit Digital teamof product managers, UX designers, copywriters, content managers,andsoftware engineers. As Product Manager(Technical)on the Digital team, you will report to the Manager of Product Management, Digital, anddeliver best-in-class web productsthat support the customer care and support experience at ecobee.Working closely withAdmin Portal,Dotcom, Customer Support, Common Platform, and internal product teams,you will beresponsible fordeliveringbusiness-criticaltools and experiencesthat effortlessly guide customers to a quickproduct supportresolution. Whetherit’s helping customers navigate the ecobee Help Centre or connecting them with an agent from our Customer Support team,our goal is to make the support experience a memorable one for all the right reasons.Thisrole willbe responsible for the customer facing ecobee support journey, an internal facing SaaSproductthat customer supportrepresentatives interact with daily, and an internaldeveloperAPIproduct that integrates all products within the ecobee portfolio. 

 

This role is open to being 100% remote within Canada although our home office is in Toronto, Ontario. You may be required to travel to Toronto, Canada once per quarter for team and/or company events.

 

How You’ll Make an Impact:  

As a Product Manager (Technical) with a customer-first mindset, you will create the best user experience for our Customer Support Team, enabling them to serve our customers via our Admin Portal tool. You will also deliver innovative customer support experiences on ecobee.com to offer customers peace of mind when purchasing a new ecobee product or seeking support for an existing product.   

You are interested in how the support experience can influence potential customers and what it communicates about ecobee. You are also passionate about bringing customer support to the next level.  Working closely with multiple stakeholders, you will develop and execute an ongoing roadmap to improve our customer support experience for both the ecobee support agents and ecobee customers. You have an unrelenting passion for customer experiences, technical know-how to work with a strong team of developers, and a strong understanding of technical support tools. 

What you will do:  

    • Create seamless and engaging end-to-end customer support experiences working with the Customer Support team and other cross-functional teams, leveraging data to make outcome-driven decisions. 
    • Develop the digital strategy and approach to various product launches that enable ecobee customer care experiences. 
    • Develop short-term and long-term product roadmaps for the Digital team centered around ecobee customer care in collaboration with Customer Support and partnering product teams. 
    • Prioritize product backlog, maintain well-defined user stories, and plan out sprints with the development team. 
    • Use agile product management methods/scrum to facilitate, daily stand-ups, backlog refinement, Kanban briefing, and retrospectives. 
    • Manage the release schedule and launch timelines across different initiatives. 
    • Establish and maintain quality, performance, and efficiency metrics for customer care products. 

 

What You’ll Bring to the Table:   

  • Experience working with product and web development teams. 
  • Experience as a Product Owner on an agile development team. 
  • Experience building and delivering complex internal platform and tooling products. 
  • Experience working with developers to design, implement, and maintain API integrations. 
  • Understanding of web development best practices and knowledge of distributed systems.  
  • You have managed teams to successfully deliver initiatives in an agile environment. 
  • Understanding of website accessibility and knowledge of accessibility requirements. 
  • Defined and implemented data-informed digital strategies to achieve a desired outcome. 
  • The ability to distill technical concepts in a clear and succinct way to business stakeholders. 
  • The ability to facilitate and guide technical and solution architecture design conversations. 
  • Experience working on Smart Home or Clean Energy sector is a plus. 

 

Application review. It will happen. By an actual person in Talent Acquisition. We get upwards of 100+ applications for some roles, it can take a few days, but every applicant can expect a note regarding their application status.

Interview Process.

  • A 30-minute phone call with a member in Talent Acquisition. 
  • A 60-minute second-round virtual interview with the hiring manager and an Engineering Manager – expect technical, behavioural, and situational questions. 
  • A 60-minute third-round virtual interview to discuss a live case study with the hiring manager, the team’s Engineering Manager, and the Sr. Director of Digital. 
  • A 60-minute fourth-round virtual panel interview with technical and business leads from the wider Digital and Customer Support teams. 

Just so you know: The hired candidate will be required to complete a background check

With ecobee, you’ll have the opportunity to: 

  • Be part of something big: Get to work in a fresh, dynamic, and ever-growing industry.  
  • Make a difference for the environment: Make a sustainable impact while on your daily job, and after it through programs like ecobee acts. 
  • Expand your career: Learn with our in-house learning enablement team, and enjoy our generous professional learning budget. 
  • Put people first: Benefit from competitive salaries, health benefits, and a progressive Parental Top-Up Program (75% top-up or five bonus days off). 
  • Play a part on an exceptional culture: Enjoy a fun and casual workplace with an open concept office, located at Queens Quay W & York St.ecobeeLeeds is based at our riverside office on the Calls. 
  • Celebrate diversity: Be part of a truly welcoming workplace. We offer a mentorship program and bias training.  

Are you interested? Let's make it work. 

Our people are empowered to take ownership of their schedules with workflows that allow for flexible hours. Based on your job, you have an option of a office-based, fully remote, or hybrid work environment. New team members working remotely, will have all necessary equipment provided and shipped to them, and we conduct our interviews and onboarding sessions primarily through video.

We’re committed to inclusion and accommodation. 

ecobee believes that openness and diversity make us better. We welcome applicants from all backgrounds to apply regardless of race, gender, age, religion, identity, or any other aspect which makes them unique. Accommodations can be made upon request for candidates taking part in all aspects of the selection process. Our recruitment team is happy to answer any questions candidates may have about virtual interviewing, onboarding, and future work locations.

We’re up to incredible things. Come and be part of them. 

Discover our products and services and learn more about who we are.  

Ready to join ecobee? View current openings. 

Please note, ecobee does not accept unsolicited resumes.  

Apply for this job

9d

Software Engineer - Video Streaming

CloudflareHybrid or Remote
Bachelor's degreeapic++

Cloudflare is hiring a Remote Software Engineer - Video Streaming

About Us

At Cloudflare, we have our eyes set on an ambitious goal: to help build a better Internet. Today the company runs one of the world’s largest networks that powers approximately 25 million Internet properties, for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Location Available: Austin, Texas

About the team

We love the Internet and media is a huge part of it. We’re working hard on building tools that change the possibilities of what Creators can do with video and images on the web. We make advanced video technologies such as adaptive bitrate, multi-codec, low latency across devices available to every developer. We enable Creators to unleash creativity on the web.

Media Platform is part of Cloudflare's Emerging Technology and Incubation organization. This is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

We are a hybrid team with offices in Austin and San Francisco, and many members working remotely.

What you'll do

  • Help build and manage a complex software system that ingests, processes and delivers petabytes of video.
  • Push forward the capabilities of real-time and low latency video communication.
  • Maintain a focus on customer experience and product quality while scaling a young product.
  • Collaborate with engineers across the whole stack and teams across Cloudflare, and contribute at many layers of the architecture.
  • Own your work from early discussions to the day it ships.
  • Work closely with product leaders and get to know customers big and small.

About you

  • You have at least two years of professional experience.
  • We primarily work in Golang and TypeScript. We recommend you have worked in one of these languages before, preferably professionally
  • You are naturally curious and willing to take a step to learn something you don’t have experience in.
  • You enjoy getting things done and have a bias for action: you're a builder and a creator.
  • You are comfortable with large scale distributed systems, and may have experience working in low-latency or real-time environments.
  • You lead. We are a growing team and you will have a huge role shaping the product from the ground up.
  • You have solid engineering fundamentals (formal computer science education a plus).
  • You may have experience with media on the internet (for example with Media Source Extensions API on browsers, FFmpeg, live streaming tools).
  • You would like to join a team that is honest and open with each other and holds each other to the highest standard. We celebrate each other's achievements and support each other when we make mistakes.

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

9d

Senior Software Engineer - Workers Runtime

CloudflareHybrid or Remote
Bachelor's degreeapic++linuxjavascript

Cloudflare is hiring a Remote Senior Software Engineer - Workers Runtime

About Us

At Cloudflare, we have our eyes set on an ambitious goal: to help build a better Internet. Today the company runs one of the world’s largest networks that powers approximately 25 million Internet properties, for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Available Locations: Austin, TX | Lisbon, Portugal | London, UK

About the Department

Emerging Technologies & Incubation (ETI) is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

About the Team

The Workers Runtime team delivers features and improvements to our Runtime which actually executes customer code at the edge. We care deeply about increasing performance, improving JS API surface area and compiled language support through WebAssembly, and optimizing to meet the next 10x increase in scale. The Runtime is a hostile environment - System resources such as memory, cpu, I/O, etc need to be managed extremely carefully and security must be foundational in everything we do.

What you'll do

We are looking for a Systems Engineer to join our team. You will work with a team of passionate, talented engineers that are building innovative products that bring security and speed to millions of internet users each day. You will play an active part in shaping product features based on what’s technically possible. You will make sure our company hits our ambitious goals from an engineering standpoint.

You bring a passion for meeting business needs while building technically innovative solutions, and excel at shifting between the two—understanding how big-picture goals inform technical details, and vice-versa. You thrive in a fast-paced iterative engineering environment.

Examples of desirable skills, knowledge and experience

  • At least 3 years of recent professional experience with C++.
  • Solid understanding of computer science fundamentals including data structures, algorithms, and object-oriented or functional design.
  • An operational mindset - we don't just write code, we also own it in production
  • Deep understanding of the web and technologies such as web browsers, HTTP, JavaScript and WebAssembly
  • Experience working in low-latency real time environments such as game streaming, game engine architecture, high frequency trading, payment systems.
  • Experience debugging, optimizing and identifying failure modes in a large-scale Linux-based distributed system.

Bonus Points

  • Experience building high performance distributed systems in Rust.
  • Experience working with cloud platforms, especially server-less platforms.
  • Experience with the internals of JS engines such as V8, SpiderMonkey, or JavaScriptCore
  • Experience with standalone WebAssembly runtimes such as Wasmtime, Wasmer, Lucet, etc
  • Deep Linux/UNIX systems, kernel, or networking knowledge
  • Contributions to large open source projects

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

9d

ThingWorx Senior Developer

TestYantra Software SolutionsUnited Kingdom Remote
agile5 years of experiencenosqlsqluiscrumapijavapostgresqljavascript

TestYantra Software Solutions is hiring a Remote ThingWorx Senior Developer

Primary Skills:

· At least 5 years of experience on ThingWorx Platform

· Strong programing background and expertise in JavaScript and Java

· Have experience in delivering IoT solution using ThingWorx Platform

· Experience on Thingworx extension development is added advantage

· Experience on Thingworx DPM and Thingworx FSU Apps (CWC, RTTPM, AMU) is added advantage

· Must have executed at least 3 medium/large implementations on ThingWorx

· Experience in writing ThingWorx services in JavaScript

· Industry standard UI creation using ThingWorx Mashups

· Experience with PTC Kepware

· Experience with DevOps is a plus

· Experience on working in scrum framework

· DBMS Skills: RDBMS (PostgreSQL, MSSQL and others) and NoSQL

· Basic understanding of SQL and API connections

· Functional understanding of JSON, REST APIs and read API documentation

· Understand business requirements and translate them into well engineered and integrated technical solutions

· Client focused to understand and appropriately respond to our client’s business needs

· Guide and mentor team members

· Versatility, flexibility, and proactivity when resolving technical issues and dealing with ambiguity

· Manufacturing experience is preferred

· Good in Communication Skills

Other Skills:

· Understanding of Agile methodologies

· Familiarity with architecture styles/APIs (REST, RPC)

· Guide and mentor team members

See more jobs at TestYantra Software Solutions

Apply for this job

9d

Senior Software Engineer Back

ShippeoParis, France, Remote
agilenosqlpostgresRabbitMQDesignmongodbscrumapisymfonyelasticsearchmysqlbackendfrontendPHP

Shippeo is hiring a Remote Senior Software Engineer Back

Job Description

Our product is composed of a mission critical SaaS web platform (API everywhere), with high traffic inbound/outbound integrations.

Our mission is to anticipate problems and proactively alert end-customers so they can efficiently manage exceptions. We achieve this by collecting and matching millions of theoretical and real data from different stakeholders.

 

The technical team is structured in three feature teams:

  • Connect to collect: quickly build highly-available integrations to fetch and send orders, events and positions (we are looking for someone to join this team in priority)

  • Track to react: automatically track orders, detect exceptions and alerts our users so they can react

  • Analyze to improve: leverage our data to improve our offer insights to our users

In a context of strong growth, we are looking for a Senior Software Engineer PHP / Symfony to deliver cutting edge solutions with a mindset oriented on delivering a production ready solution.

Reporting to the Engineering Manager, your work will focus on improving our technical architecture and developing new functionalities. You will be responsible for all aspects : technical design, development, testing, documentation, deployment and maintainability.

What you will do:

  • Design and maintain server-side application logic using PHP Symfony in an event-driven environment

  • Write qualitative, readable and tested code

  • Collaborate with front-end developers on designing the most performant and scalable APIs

  • Design and optimize applications for high performance, high availability and high scalability

  • Ensuring optimal performances of the requests to the databases

  • Document your processes, your APIs using OpenAPI and the database schemas

  • Apply new architectural patterns within our stack : DDD, CQRS, event sourcing, micro-services

  • Keep informed of advancements in the field of engineering

 

Generally composed of 2 backend developers, 2 frontend developers, 1 product manager, 1 product designer, each feature team has the full ownership for selecting and delivering the features that will have the greatest impact for our users. Close collaboration, agile method and tests: we try every sprint to improve our processes.

Your stack :

  • Stack : PHP (Symfony 6.4) 

  • Event Driven Design philosophy: DDD Main Patterns : CQRS, Event sourcing

  • Asynchronous event model (RabbitMQ)

  • Interface: API REST

  • Testing : Phpspec, Phpunit, Phpstan,

  • Database: Postgres, MySQL,MongoDB,Postgres, Time Series Database, Algolia,

  • EventStoreDB Methodology : OKR, Scrum, Event storming

Qualifications

We are looking for a developer with a good knowledge of the technologies we use, but what matters most is that:

  • You are passionate, experienced and enjoy working in a team in an agile context

  • You are not afraid to confront new problems and overcome them

  • You deliver qualitative, powerful and tested code 

 

Your Profile :

  • Must have experience with a event driven architecture
  • Software Engineering in a highly paced environment

  • Must have experience in developing server-side application logic using PHP Symfony

  • Must have experience with at least one relational database and a noSQL database

  • Familiarity with RabbitMQ, Grafana, Kibana, ElasticSearch

  • You develop pragmatic solutions without overengineering, and choose simple, straightforward solutions over more complex ones

  • You align your work with the company's business objectives and seek to deliver business value

  • You have a strong emphasis on developing solutions that are production ready with a mindset oriented towards you build it, you run it

See more jobs at Shippeo

Apply for this job

9d

Senior Frontend Engineer

BloomreachBratislava, Slovakia/Prague, Czech Republic/Brno, Czech Republic (Remote CEE)
remote-firstDesignswiftuiapiUXgitc++typescriptcssangularjavascriptfrontend

Bloomreach is hiring a Remote Senior Frontend Engineer

Bloomreach is the world’s #1 Commerce Experience Cloud, empowering brands to deliver customer journeys so personalized, they feel like magic. It offers a suite of products that drive true personalization and digital commerce growth, including:

  • Discovery, offering AI-driven search and merchandising
  • Content, offering a headless CMS
  • Engagement, offering a leading CDP and marketing automation solutions

Together, these solutions combine the power of unified customer and product data with the speed and scale of AI optimization, enabling revenue-driving digital commerce experiences that convert on any channel and every journey. Bloomreach serves over 850 global brands including Albertsons, Bosch, Puma, FC Bayern München, and Marks & Spencer. Bloomreach recently raised $175 million in a Series F funding round, bringing its total valuation to $2.2 billion. The investment was led by Goldman Sachs Asset Management with participation from Bain Capital Ventures and Sixth Street Growth. For more information, visit Bloomreach.com.

 

Do you love frontend development and are you good at it? Would you like to build a large-scale & fast evolving app using Angular & TypeScript? Would you like to talk about why we might be the best team for you to join right now?? Curious? Read on!
(Your s
alary starts from 3300€ per monthwith stock options and other benefits included. Working in one of ourCentral Europe offices or from homeon afull-time basis.)

What tech stack do we have for you?

  • Typescript and Javascript
  • Angular
  • SCSS/CSS
  • NodeJS
  • RxJS
  • Karma/Jasmine/Cypress
  • GIT

About your role and the team:

We are a team of thirteen people at the moment. We cooperate tightly as a single unit on a multitude of tasks and challenges in order to make our application the best to serve our customers’ needs. Since not all of us enjoy tasks with a focus on styling, a subteam of stylers has been formed that takes care of our UI library of low-level components. 

We are facing a variety of tasks on our daily basis that fall mostly into three categories - designing and developing new features, maintaining existing features in the underlying codebase and sometimes prototyping new features as POCs.

What we expect of the candidate:

Must have

  • advanced TypeScript (or JavaScript with a strong will to switch to TypeScript)
  • advanced Angular (or similar component-based framework with a strong will to switch to Angular)
  • experience with software design & architecture (be able to propose and implement an effective & efficient solution based on problem definition without detailed instructions)
  • The ability to work in project teams effectively, being reliable and communicating clearly.
  • A “can-do” attitude

Should have

  • experience with developing bigger projects
  • At least an intermediate skill with SCSS / CSS (be able to get things done in reasonable quality if your styler colleagues are busy)

Preferably have

  • experience with testing (Karma, Jasmine, Cypress)
  • experience with RxJS

Nice have

  • experience with mentoring less experienced colleagues

How we work:

Our entire engineering team works in 6 week cycles. Each developer is assigned to one or more projects during this cycle and aims to deliver the project together with other project team members from various other teams. In addition to working on projects, we also focus on other tasks - not limited to working on our backlog, providing an L3 support to our client facing colleagues or making improvements to our product through an initiative called “Happy consultants”.
In order to keep our high quality standards, each change in code we do gets reviewed and our automated pipeline builds these changes, runs a series of tests, runs the linter, packages the outputs and deploys them onto a development environment.
We are a team of diverse skill sets - you will need to share your experience and knowledge (during code reviews and ideally also beyond) with other colleagues and help them grow just like we all will help and support you from the minute you join us.

Challenges:

Here are some of the challenges that kept us busy in the past:

  • Micro frontend research
    • Our application is split up into modules but we are experimenting with the idea of loosening up the coupling even a bit more and splitting our large application into a collection of smaller ones run under a single container application.
    • Identify the pros and cons of this approach and what problems will it solve effectively and what other problems it might bring.
    • Take into account how this switch potentially affects not the architecture alone but also the execution, deployment and DX.
  • Optimizing build performance
    • The larger an application gets, the more complex the build becomes. Our application consists of hundreds of components, directives, services, pipes and other functions.
    • Find a way to optimise the build in order to make the DX and the pipeline build performance better.
  • Optimizing change detection
    • Our application aims to deliver a swift interaction experience to its users without the feeling that something is lagging.
    • Identify components that are underperforming.
    • Analyze their bottlenecks using the profiler.
    • Optimize the runtime performance of the problematic code parts.
  • Data visualisation
    • Our real-time analyses like trends, funnels, reports, and segmentations allow users to gain insights about their data from multiple perspectives. We integrate with external data sources spanning multiple relational databases and big data storage systems.
    • Build an interface for users to query data from data sources located outside of the Engagement to build the basis for our analyses and visualizations.
    • Create complex data visualizations using the Highcharts library or similar suitable tool.
    • Be proactive in proposing solutions which will help users to better understand their data.
    • Improve test quality and extend test coverage.
  • Extend UI library
    • We have created a mature UI library with the goal in mind to unify the look, behavior, and the API of our reusable components. This library already consists of a solid foundation of components but the innovation in the Engagement goes hand in hand with the need to create new components and enhance existing ones.
    • Create new reusable components while focusing on clear API, stability, best possible UX and modern browser support.
    • Test your component well. Use unit tests to cover all thinkable and unthinkable scenarios your component may go through to make it robust.
  • Other than that…
    • We work hard to have sustainable code, but we still have some code in our codebase, especially from the early startup era, that was written in haste to keep the business running - you will need to be able to get around in complex code and help us refactor it.
    • Automated testing of our code is important to us. You will need to cover your code, help us improve existing test quality and extend overall test coverage - spanning from unit tests, through integration tests to automated e2e tests.

Regional benefits:

  • Monthly lunch entitlement by up to 110€ per month
  • Pension scheme or Health insurance depending on region

#LI-DU1

More things you'll like about Bloomreach:

Culture:

  • A great deal of freedom and trust. At Bloomreach we don’t clock in and out, and we have neither corporate rules nor long approval processes. This freedom goes hand in hand with responsibility. We are interested in results from day one. 

  • We have defined our5 valuesand the 10 underlying key behaviors that we strongly believe in. We can only succeed if everyone lives these behaviors day to day. We've embedded them in our processes like recruitment, onboarding, feedback, personal development, performance review and internal communication. 

  • We believe in flexible working hours to accommodate your working style.

  • We work remote-first with several Bloomreach Hubs available across three continents.

  • We organize company events to experience the global spirit of the company and get excited about what's ahead.

  • We encourage and support our employees to engage in volunteering activities - every Bloomreacher can take 5 paid days off to volunteer*.
  • TheBloomreach Glassdoor pageelaborates on our stellar 4.6/5 rating. The Bloomreach Comparably page Culture score is even higher at 4.9/5

Personal Development:

  • We have a People Development Program -- participating in personal development workshops on various topics run by experts from inside the company. We are continuously developing & updating competency maps for select functions.

  • Our resident communication coachIvo Večeřais available to help navigate work-related communications & decision-making challenges.*
  • Our managers are strongly encouraged to participate in the Leader Development Program to develop in the areas we consider essential for any leader. The program includes regular comprehensive feedback, consultations with a coach and follow-up check-ins.

  • Bloomreachers utilize the $1,500 professional education budget on an annual basis to purchase education products (books, courses, certifications, etc.)*

Well-being:

  • The Employee Assistance Program -- with counselors -- is available for non-work-related challenges.*

  • Subscription to Calm - sleep and meditation app.*

  • We organize ‘DisConnect’ days where Bloomreachers globally enjoy one additional day off each quarter, allowing us to unwind together and focus on activities away from the screen with our loved ones.

  • We facilitate sports, yoga, and meditation opportunities for each other.

  • Extended parental leave up to 26 calendar weeks for Primary Caregivers.*

Compensation:

  • Restricted Stock Units or Stock Options are granted depending on a team member’s role, seniority, and location.*

  • Everyone gets to participate in the company's success through the company performance bonus.*

  • We offer an employee referral bonus of up to $3,000 paid out immediately after the new hire starts.

  • We reward & celebrate work anniversaries -- Bloomversaries!*

(*Subject to employment type. Interns are exempt from marked benefits, usually for the first 6 months.)

Excited? Join us and transform the future of commerce experiences!

If this position doesn't suit you, but you know someone who might be a great fit, share it - we will be very grateful!


Any unsolicited resumes/candidate profiles submitted through our website or to personal email accounts of employees of Bloomreach are considered property of Bloomreach and are not subject to payment of agency fees.

 #LI-Remote

See more jobs at Bloomreach

Apply for this job

9d

Senior Product Manager

agilesqlscrumapiUX

Integral Ad Science is hiring a Remote Senior Product Manager

Integral Ad Science (IAS) is a leading global media measurement and optimization platform that delivers the industry’s most actionable data to drive superior results for the world’s largest advertisers, publishers, and media platforms. IAS’s software provides comprehensive and enriched data that ensures ads are seen by real people in safe and suitable environments, while improving return on ad spend for advertisers and yield for publishers. Our mission is to be the global benchmark for trust and transparency in digital media quality. For more information, visit integralads.com.

We are looking for a Product Manager to create, develop, and bring a new data measurement marketplace to the AdTech ecosystem. This exciting role will be focused on providing our customers with a way of aggregating data points from a variety of partners into a holistic, scalable solution. 

The ideal candidate has the track record of inspiring and energizing teams to create future visions of the product, articulating customer problems and market opportunities, analyzing industry trends, making priority decisions and clarifying trade-offs, and working with your colleagues across roles to break that down into an adaptable plan that delivers value to our customers. Innovation and challenging the status quo are in our team’s DNA. We are looking for someone who can bring fresh perspectives to drive product innovation. 

What you’ll get to do:

  • Develop products and features that help marketers leverage our rich impression level data into actionable insights with delightful design.
  • Build a 1st & 3rd party partner data/measurement ecosystem for commercial offerings, & evaluate the best path to create value, integrate (data in) or syndicate data (data out).
  • Define and lead execution of API & Data Product strategy through close collaboration with Engineering, Data Science, Business Development, and Sales
  • Create new revenue streams by launching and shipping new data products to market
  • Lean into previous cross Channel Attribution experience, including ROI measurement in order to measure lift using attribution windows and synthetic test & control groups
  • Driving continued functionality and improvement of IAS Signal, our unified reporting platform
  • Guide day-to-day development within an agile / scrum environment
  • Perform analyses, seek user feedback, collect/generate ideas and prioritize for development
  • Collaborate with internal stakeholders - engineering, business development, data science, and product peers to refine opportunities and roadmap
  • Define detailed requirements and groom the corresponding backlog to deliver features used by large advertisers and advertising platforms across the globe
  • Define, manage, and track key product delivery KPIs
  • Partner with UX Designers and Researchers 

You should apply if you have most of this experience: 

Bachelor’s degree in Engineering or other related field

  • Prior experience working within a data analytics environment, visualization experience is a plus
  • 5+ years of hands-on product management experience and collaborating directly with development teams
  • Familiar with LLM and ML models and concepts
  • Proven experience shipping high-quality products with measurable impact
  • Experience within an Agile product development environment with an emphasis on continuous improvement

Intellectual curiosity, passion for learning new technology, able to identify market trends

  • A track record of building, maintaining, and managing strong relationships within an international business and across many different stakeholder groups
  • Strong written and verbal communication skills and the ability to communicate technical concepts to technical and non-technical audiences
  • Working knowledge of SQL, Snowflake, and/or data-bricks is a plus

About Integral Ad Science

Integral Ad Science (IAS) is a leading global media measurement and optimization platform that delivers the industry’s most actionable data to drive superior results for the world’s largest advertisers, publishers, and media platforms. IAS’s software provides comprehensive and enriched data that ensures ads are seen by real people in safe and suitable environments, while improving return on ad spend for advertisers and yield for publishers. Our mission is to be the global benchmark for trust and transparency in digital media quality. For more information, visit integralads.com.

Equal Opportunity Employer:

IAS is an equal opportunity employer, committed to our diversity and inclusiveness. We will consider all qualified applicants without regard to race, color, nationality, gender, gender identity or expression, sexual orientation, religion, disability or age. We strongly encourage women, people of color, members of the LGBTQIA community, people with disabilities and veterans to apply.

California Applicant Pre-Collection Notice:

We collect personal information (PI) from you in connection with your application for employment or engagement with IAS, including the following categories of PI: identifiers, personal records, commercial information, professional or employment or engagement information, non-public education records, and inferences drawn from your PI. We collect your PI for our purposes, including performing services and operations related to your potential employment or engagement. For additional details or if you have questions, contact us at compliance@integralads.com.

To learn more about us, please visithttp://integralads.com/ 

Attention agency/3rd party recruiters: IAS does not accept any unsolicited resumes or candidate profiles. If you are interested in becoming an IAS recruiting partner, please send an email introducing your company to recruitingagencies@integralads.com. We will get back to you if there's interest in a partnership.

#LI-Remote

See more jobs at Integral Ad Science

Apply for this job

9d

Senior Software Engineer, Full-stack

TaniumRemote, Canada
agileBachelor's degreesalesforceDesigngraphqlapigitrubyjavac++jenkinspythonbackendNode.js

Tanium is hiring a Remote Senior Software Engineer, Full-stack

The Basics

As a Senior Software Engineer at Tanium, you will build and maintain best-of-breed products as part of a nimble development team. Tanium focuses on a customer engagement model and feedback process to ensure our products are designed the right way from the beginning. When new products ideas are identified, our software engineers design, develop, test, and deploy the products from the ground up, while iterating with product management and customers for feedback and input.

What you'll do

  • Build and maintain Tanium's products alongside an agile development team
  • Design, develop and test new product ideas from the ground up while working with product management for feedback and input
  • Work on small teams that tackle big challenges in common components like a common data service tasked with unifying and consolidating endpoint data across the entire ecosystem, handling time series data that drive dashboarding and reporting, and exposing data externally through GraphQL enabling partners (like Salesforce) to easily integrate
  • Delivering higher level services enabled by our core services that directly enable our products and focus on everything from security to operations to auditing

 

Education

  • Bachelor's degree or equivalent experience
  • CS Degree preferred

Experience

  • 5+ years industry experience
  • Experience designing and building high-impact, high-performance, scalable, observable, and maintainable backend services and APIs 
  • Knowledge of at least one of Golang (preferred), Node.js, Python, Ruby, Rust, or Java
  • Experience with HTTP API design and development
  • Experience with modern software engineering development and automation tools like git and Jenkins

Other

  • Demonstrates sound judgment for balancing between rapid development, long-term code maintainability and supportability
  • Believes in the power of and the need for writing automated tests as part of development
  • Experienced debugger who can put out fires under pressure when things go wrong in production environments
  • Has knowledge of a variety of modern software frameworks (server side & browser side) and the versatility to learn new tools

About Tanium 

Tanium, the industry’s only provider of converged endpoint management (XEM), leads the paradigm shift in legacy approaches to managing complex security and technology environments. Only Tanium protects every team, endpoint, and workflow from cyber threats by integrating IT, Operations, Security, and Risk into a single platform that delivers comprehensive visibility across devices, a unified set of controls, and a common taxonomy for a single shared purpose: to protect critical information and infrastructure at scale. Tanium has been named to the Forbes Cloud 100 list for six consecutive years and ranks on Fortune’s list of the Best Large Workplaces in Technology. In fact, more than half of the Fortune 100 and the U.S. armed forces trust Tanium to protect people; defend data; secure systems; and see and control every endpoint, team, and workflow everywhere. That’s the power of certainty. Visit www.tanium.com and follow us on LinkedIn and Twitter.

On a mission. Together. 

At Tanium, we are stewards of a culture that emphasizes the importance of collaboration, respect, and diversity. In our pursuit of revolutionizing the way some of the largest enterprises and governments in the world solve their most difficult IT challenges, we are strengthened by our unique perspectives and by our collective actions.   

We are an organization with stakeholders around the world and it’s imperative that the diversity of our customers and communities is reflected internally in our team members. We strive to create a diverse and inclusive environment where everyone feels they have opportunities to succeed and grow because we know that only together can we do great things. 

Each of our team members has 5 days set aside as volunteer time off (VTO) to contribute to the communities they live in and give back to the causes they care about most.   

What you’ll get

The annual base salary range for this full-time position is C$95,000 to C$280,000. This range is an estimate for what Tanium will pay a new hire. The actual annual base salary offered may be adjusted based on a variety of factors, including but not limited to, location, education, skills, training and experience.

 

 

For more information on how Tanium processes your personal data, please see our Privacy Policy.

See more jobs at Tanium

Apply for this job

10d

Python DevOps Developer H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
agilejiraterraformansibleazureapigitc++dockerkuberneteslinuxjenkinspythonAWS

Devoteam is hiring a Remote Python DevOps Developer H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que Python DevOps Developer 

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

  • Comprendre le besoin utilisateur et y répondre en livrant régulièrement des fonctionnalités ayant de la valeur métier,

  • Assurer le développement d’outils visant à industrialiser/automatiser le déploiement sur les différents environnements du développement à la production (conception & structuration, qualité de code, pair-programming, revue de code…),

  • Accompagner les équipes de dev par la mise en place de pipelines CI/CD, d’Infra As code et de conteneurs pour leurs applications,

  • Accompagner les équipes de production dans la mise en place de bonnes pratiques de delivery de ces outils (gestion de sources, gestion de configuration, automatisation des tests…) ;

  • Apporter la culture du développement agile dans les différentes features teams, faciliter la coopération et l'entraide, partager la connaissance via les outils

  • Intervenir au sein d’écosystèmes techniques DevOps et des plateformes de CI/CD complexes pour des milliers d’utilisateurs 

  • Assurer une veille technologique et s'intéresser aux nouvelles pratiques émergentes

Selon les projets, voici les technologies que vous serez amené.e à rencontrer :

  • Scripting : Python, Bash, Shell

  • Programmation : Python, Django, Flask

  • Architectures orientées services (MicroServices & REST API)

  • CI/CD : Gitlab, GitHub, Jenkins, Nexus, Sonarqube

  • Versionning : Git

  • Containers : Docker, Kubernetes

  • Infrastructure As Code : Terraform, Ansible

  • Collaboration : Jira, Confluence

  • Tests : Selenium

  • Système : Windows, Linux

  • Cloud : AWS, AZURE, GCP

Qualifications

Ce que vous apporterez à la Tribu ?

[Les compétences idéales] 

Diplômé.e d’une École d’Ingénieurs ou d’un Master 2 en IT, vous êtes passionné.e par le langage Python dans des contextes Cloud / DevOps et avez au moins 3 ans d’expérience en scripting ou développement sur Python 3 et ses librairies. Que vous veniez du Dev, des Ops, du DevOps, vous avez acquis de solides compétences en automatisation et amélioration continue.

Vous avez déjà une première expérience dans l’utilisation ou la mise en place d’outils de l’écosystème DevOps - CI/CD et vous souhaitez aller plus loin sur ces sujets.

[Cherries on the cake????]

  • Une expérience des frameworks Flask & Django et des outils d’industrialisation (Git, Jenkins, Ansible, Docker…)

  • Une expérience en utilisation ou implémentation de plateformes CI/CD avec des composants “Enterprise” (GitLab / GitHub)

  • Des connaissances et de la pratique en conteneurisation et sur un Cloud provider 

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

10d

QA Automation Engineer

MobicaWarsaw, Poland, Remote
apijavapython

Mobica is hiring a Remote QA Automation Engineer

Job Description

Our Customer is a leading global provider of cutting-edge payments technology solutions, dedicated to shaping the future of financial transactions worldwide. With a commitment to innovation and excellence, we connect consumers, businesses, financial institutions, and governments in over 200 countries and territories through our advanced processing networks.

We are currently looking for seasoned Quality Assurance and Automation engineer fluent in Python and Java frameworks. This job requires manual and automated application tests including API testing. Additional tasks will require work with scripting languages and PL/SQL databases.

This is a hybrid work opportunity, requiring attendance at the customer's office in Warsaw twice a week for team relationship-building purposes.

Due to the nature of our work in the financial market, candidates will be subject to detailed background screening including education, employment history, and criminal record.

Qualifications

Must Have

  • Automation with Python and Java frameworks skills
  • Manual Testing
  • Automated Testing
  • API testing experience
  • Familiarity with Scripting languages
  • Knowledge of PL/SQL database 

See more jobs at Mobica

Apply for this job

10d

Senior Test Engineer with experience in Web and API application Testing

MobicaWarsaw, Poland, Remote
agile5 years of experiencejiraDynamicsDesignuiscrumapiqa

Mobica is hiring a Remote Senior Test Engineer with experience in Web and API application Testing

Job Description

Our Customer is a leading global provider of cutting-edge payments technology solutions, dedicated to shaping the future of financial transactions worldwide. With a commitment to innovation and excellence, we connect consumers, businesses, financial institutions, and governments in over 200 countries and territories through our advanced processing networks.

We are currently looking for a Test Engineer to join the Test Engineering team which is responsible for managing system requirements, design, development, integration, quality assurance, implementation, and maintenance of corporate applications.

The team works closely with business owners of these services to deliver industry-leading packaged software and customer-developed solutions. The diversity of applications provides incredible opportunities to learn multiple aspects of the business while gaining experience across a wide variety of technology stacks.

As a team member you will:

  • Collaborate with developers and QA engineers in agile development framework.
  • Build strong relationships with external teams with a goal of developing robust end-to-end test coverage.
  • Work with the team to increase the test coverage.
  • Execute test cases during all stages of development and release cycle.
  • Design and executing test plans, scenarios, and scripts.
  • Identify process deficiencies and suggest improvements.
  • Conduct test plan reviews with QA leads and stakeholders.
  • Document software defects, using a bug tracking system, and report defects.
  • Determine risks to test deliverables and create mitigation plans.
  • Monitor bug resolution efforts and track successes.
  • Define test parameters, design tests, interpret test results and analyze test trends.
  • Assist in managing the test platforms. 
  • Work with QA leads to develop and improve effectiveness of automation.

This is a hybrid work opportunity, requiring attendance at the customer's office in Warsaw twice a week for team relationship-building purposes.

Due to the nature of our work in the financial market, candidates will be subject to detailed background screening including education, employment history, and criminal record.

Qualifications

Qualifications

  • 3-5 Years of experience in Web and API application Testing.
  • Experience in writing test cases using Zephyr, Jira, HP ALM or similar tools.
  • Experience in testing SAAS (Software as a Service) application is a plus.
  • Experience with CRM platforms such as Microsoft Dynamics is a plus.
  • Experience in debugging & Running the Test cases and analyzing the Test Results.
  • Experience in understanding Requirement Specifications and Design Documents.
  • Experience with all aspects of SDLC and STLC.
  • Experience with Functional & Non-Functional Testing & Regression Testing.
  • Experience in preparing Test Documentation (Test Scenarios, Test Plan, Test Findings, Test Data, Test Cases & Defect Reports).
  • Experience in defect management process using Jira, Bugzilla or similar tools.
  • Timely reporting of Status / Risks / Issues to client by direct interaction in Client Status Calls / Program Calls / Scrum calls and by status emails.
  • Experience in presenting Demos sessions to stake holders during different releases of UAT. Preparation of Daily Status Report (DSR), Weekly Status Report (WSR).
  • UI and API Automation Testing is a plus.
  • Experience in collaboration with on-shore and off-shore teams.
  • Possess excellent interpersonal, communication & analytical skills with demonstrated abilities in customer relationship management.

See more jobs at Mobica

Apply for this job

10d

Senior Software Engineer (Python, NodeJS)

Pure IntegrationPhiladelphia, PA, Remote
agileBachelor's degreenosqlsqlDesignapijavapostgresqlmysqlkuberneteslinuxpython

Pure Integration is hiring a Remote Senior Software Engineer (Python, NodeJS)

Job Description

We are seeking a Senior Software Engineer (Python, NodeJS)to join our growing team. You will be working on maintaining the Notifications and Voice Suggestions services and will be involved with the Arbitration Engine team in supporting the Software Engineering and Data Engineering work.

If you are a creative problem solver, enjoy translating high-level requirements into actionable solutions, and enjoy a fast-paced, dynamic environment, this could be the perfect opportunity for you.

This position is a remote(in the U.S.) position, and will be a W-2 hourlycontract for the remainder of 2024 with possible extension.

The hourly rate is $64/hr. – $67/hr. and will be paid within this range based on work experience and skills. Candidates are also eligible for limited benefits such as health insurance, professional development, trainings, our referral bonus program, and our wellness program.

Responsibilities:

  • Analyze requirements, design, develop, and unit test code.
  • Design software architecture for multiple services.
  • Develop and design ML model training pipelines and integrate them into API-based services.
  • Resolve technical issues through debugging, research, and investigation.
  • Collaborate within the team and with external teams.
  • Facilitate the rollout of software releases.
  • Track and evaluate performance metrics.
  • Work on Continuous Integration/Continuous Deployment (CI/CD) pipelines.
  • Participate in on-call duties.
  • Ensure regular, consistent, and punctual attendance, including availability for nights, weekends, and overtime as necessary.
  • Perform other duties and responsibilities as assigned.

Qualifications

  • Bachelor's degree in Computer Science or a related field.
  • 7+ years of experience writing efficient code and serving as a technical leader.
  • Expertise in Python or other languages like Java, Golang, or JavaScript.
  • Experience with SQL or NoSQL databases (e.g., MySQL, PostgreSQL, DynamoDB, Redis).
  • Strong background in working with Machine Learning models, including integration into API-based services and training.
  • Familiarity with Databricks, Pyspark, and optimizing Data Pipelines.
  • Knowledge of Data Engineering principles.
  • Experience in a self-sufficient DevOps team, responsible for software development and deployment.
  • Proficiency in CI/CD pipelines and AWS.
  • Familiarity with Kubernetes, Bash, Linux environments, and monitoring tools like Prometheus/Grafana.
  • Agile practices experience.

See more jobs at Pure Integration

Apply for this job

10d

Front-End Developer (Contract position)

DevelopexKyiv, Dnipro or remote, UA Remote
Commercial experienceapi

Developex is hiring a Remote Front-End Developer (Contract position)

We are looking for a Front-End Developerfor the enterprise application that should help generate schedules and send surveys for different user groups (teams) and then manage the statistics based on the responses.

Requirements:

  • 3+ years of commercial experience in Front-End Development;
  • 1+ years of working experience with Vue.JS;
  • Strong experience with JS, HTML/CSS, REST API;
  • Successful experience of working independently on the front-end of the project;
  • Attention to detail and ability to adhere to code standards;
  • Intermediate level of English or above.

We offer:

  • Comfortable and flexible working schedule;
  • Comfortable office in the old center of the city (Podil);
  • Meeting, lounge and sleeping rooms in the office;
  • Social benefits, paid vacations and sick-leaves;
  • Yoga classes, table tennis and football on-site;
  • Compensation of medical service;
  • Free fruits and sweets, unlimited milk-tea-coffee-oatmeal;
  • English classes in the office.







      See more jobs at Developex

      Apply for this job

      10d

      Senior Software Engineer (Hybrid/Remote)

      Oasis Africa Consulting LimitedJakande, Lekki, Nigeria, Remote
      agileDesignhtml5scrumapiqagittypescriptAWSjavascriptbackendNode.js

      Oasis Africa Consulting Limited is hiring a Remote Senior Software Engineer (Hybrid/Remote)

      Job Description

       

      Desired Abilities- Ability to:

      Design, develop, and maintain high-quality, scalable, and secure software solutions using Node.js, TypeScript, and AWS technologies.

      Collaborate with cross-functional teams, including product management, UX/UI design, and QA, to gather requirements, define specifications, and ensure the successful delivery of projects.

      Architect and implement efficient, maintainable, and modular code in javascript and Typescript, adhering to best practices, coding standards, and established guidelines.

      Optimise application performance by identifying bottlenecks, implementing solutions, and conducting regular code reviews.

      Leverage AWS services and tools to design and implement cloud-native applications, ensuring optimal performance, security, and cost-effectiveness.

      Participate in the entire software development lifecycle, from planning and design to deployment and maintenance, ensuring smooth project execution.

      Stay up-to-date with industry trends, emerging technologies, and best practices in software engineering, particularly within the Node.js, TypeScript, and AWS ecosystems.

      Troubleshoot, diagnose, and resolve software issues, providing timely and practical solutions to ensure minimal user disruption.

      Collaborate with the other engineering team members to ensure smooth CI/CD pipelines, infrastructure management, and monitoring and alerting systems.

       

      You could be an ideal match if you possess:

      4+ years of professional experience in software development, focusing on web applications and backend services using JavaScript, TypeScript, and Node.js. You will need to have strong proficiency in JavaScript, TypeScript, and Node.js with a deep understanding of core concepts, asynchronous programming, and performance optimisation techniques.

      2+ years of experience working with front-end frameworks, preferably Vue.js - and a solid understanding of HTML5, CSS3, and related web technologies - in building user-friendly and responsive web applications.

      Familiarity with Agile development methodologies, such as Scrum or Kanban, and experience working in an Agile environment.

      Some experience with NestJS, a progressive Node.js framework, and familiarity with its underlying principles, such as dependency injection and modularity, is a plus.

      Knowledge of Domain-Driven Design (DDD) concepts and experience implementing DDD principles in software projects is valuable.

      Familiarity with AWS services such as EC2, S3, Lambda, API Gateway, RDS, and Load balancers, and experience building scalable and secure cloud-based applications.

      Knowledge of RESTful API design principles.

      Experience with version control systems, preferably Git, and understanding of best code management and collaboration practices.

      Proficiency in writing and maintaining unit, integration, and end-to-end tests using testing frameworks such as Jest, Mocha, or Jasmine.

      Good knowledge of software development best practices, including design patterns, code modularity, and maintainability.

      Strong problem-solving skills, with the ability to analyse complex issues, develop practical solutions, and adapt to changing requirements.

      Excellent communication and collaboration skills, with the ability to work effectively in a team-oriented environment.

      Qualifications

       

      An engineering degree is not a prerequisite; instead, we highly value relevant experience in software development and a demonstrable portfolio of projects that highlight your skills.

      See more jobs at Oasis Africa Consulting Limited

      Apply for this job

      11d

      Manager, Enterprise Operations

      remote-firstsalesforceapic++

      Feedonomics is hiring a Remote Manager, Enterprise Operations

      Manager, Enterprise Operations - Feedonomics - Career Page

      See more jobs at Feedonomics

      Apply for this job

      Brightspeed is hiring a Remote Platform Program Manager, Enterprise & Wholesale

      Job Description

      Brightspeed has an exciting opportunity for a Platform Program Manager, Enterprise & Wholesale to join our rapidly growing team! As an individual contributor, you will be responsible for technical and non-technical program management, requirements gathering and verification, UAT, ORT, Go/No Go decisions, release support and program management lifecycle. You will work closely with IT and Business Operations teams to ensure alignment of processes and visions. The principal purpose of this role is to ensure consistent program management, on time / budget program release and effective communication for all programs assigned. This position will report to the Sr. Manager, Product & Platform Innovation – Governance. 

      As a Platform Program Manager, Enterprise & Wholesale, your responsibilities will include: 

      • Lead the domain to develop and drive Enterprise & Wholesale TSA exit related strategies, requirements, ORT and implementation in alignment with business strategies 
      • Help develop a scalable and robust cross-domain system stack that caters to Enterprise and Wholesale (E&W) customers’ needs and business outcomes 
      • Define E&W product and platform excellence and enable operational efficiencies, through key analytics, enhancing product and service delivery, customer experiences 
      • Create cohesive cross domain Mass Markets (MM) and Enterprise & Wholesale (E&W) operational system support (OSS) and business system support (BSS) stacks that allow a seamless experience and internal cost efficiencies while maximizing system platform, network capabilities and customer experiences 
      • Support the Product and Platform Innovation team by managing assigned targeted efforts to completion 
      • Manage E2E program management life cycle for the Enterprise & Wholesale (E&W) platform stack 
      • Support application / platform UAT, ORT, JIRA management, release scheduling and system integration 
      • Develop and evaluate program plans to document scope, schedule, tasks, and risk management 
      • Ensure progress of assigned complex program/processes within budgetary and scheduling guidelines 
      • Creation and tracking of programs; escalate and track program issues; document progress and prepare status reports (metrics, summaries, etc.) to be communicated in both formal and informal settings 
      • Assist in ensuring that each program is executed with high quality and meets the measures of success 
      • Demonstrated exceptional presentation, interpersonal, relationship development, analytical, problem-solving and communication skills with the ability to present at the senior most level in the business 

      Qualifications

      WHAT IT TAKES TO CATCH OUR EYE: 

      • Bachelor’s degree in Project  / Program Management, Business, or related field 
      • 8+ years of experience managing cross-functional and/or cross team programs 
      • 7+ years of strong technical experience, preferably in telecommunications or software development, preferably with knowledge including but not limited to:  
      • Network technology configuration / implementation 
      • Ethernet 
      • Optical 
      • Product configuration / implementation  
      • WAN 
      • LAN 
      • Wi-Fi 
      • Managed Services 
      • Software development  
      • Portals 
      • API 
      • Orchestration 
      • Successful teamwork experience and demonstrated leadership abilities 
      • Self-directing and the ability to work with minimal supervision 
      • Must be able to read, understand and apply technical standards 
      • Ability to translate technical terms into plain language 
      • Ability to manage multiple projects / programs simultaneously and pivot quickly 
      • Excellent client-facing and internal communication skills 
      • Excellent PowerPoint & presentation skills  
      • Quick learner with excellent written & verbal communication and analytical problem-solving skills 
      • Solid organizational skills with attention to detail, context switching, and cope with tight deadlines 
      • Proficient in Microsoft Office applications 
      • Proficient in program planning and life cycle development tools 

      BONUS POINTS FOR: 

      • Deep familiarity with fiber technology 
      • Certified Project / Program Management Professional (PMP)-PM or Project / Program Management Degree 
      • SmartSheets Knowledge 
      • JIRA Knowledge 

       

      #LI-SS1

      See more jobs at Brightspeed

      Apply for this job

      11d

      Senior Full Stack Software Engineer - Cloud Applications

      JitterbitSão Paulo, Brazil, Remote
      DesignapijavadockerelasticsearchmysqltypescriptcsskuberneteslinuxangularAWSjavascriptNode.js

      Jitterbit is hiring a Remote Senior Full Stack Software Engineer - Cloud Applications

      Job Description

      Jitterbit is seeking a Senior Full Stack Software Engineer to join our Cloud Applications team. Jitterbit is an iPaaS (Integration as a Service) and API Management platform who has been recognized in the leader quadrant of Gartner for five straight years. Our customers use our iPaaS and APIM platform to solve mission critical business problems. What is our challenge? To make it easy to integrate our customers’ systems. In order to do this, we need to build and create a SaaS offering that is reliable, stable, and scalable for our customers. Do you have the design, architecting, and code-writing capabilities to take on this challenge? And can succeed in a big way?

      ABOUT THE TEAM

      The engineering team at Jitterbit believes that the quality of our code reflects directly on us as professionals. We are relentless about crafting a product that is innovative and delivers a memorable user experience; an experience that is fast and robust. As a key engineer on our team, you will collaborate with other engineers, product management, and operations. Our culture is fun, fast-paced, performance-oriented, open, and collegial. We are constantly pushing the technology envelope to the edge! We are very distributed and our culture is set up to make all of us very effective working remotely. We believe in hiring talent where it exists.

      ABOUT THE JOB

      You will be helping us build, design, and architect awesome and new capabilities on our various Cloud Application products. We are looking for a senior full stack engineer. You will be working with Angular, TypeScript, Node.js, CSS3, Nginx, Tomcat, Kafka, Elasticsearch, MySQL, Linux, Docker, and Kubernetes; to name a few of the technologies we use in our Cloud Apps team. You will have full lifecycle responsibilities to create robust, scalable, and distributed systems that operate flawlessly 24x7x365. You will have an opportunity to learn new things. We’re always expanding into new areas, exploring new technologies and pushing the frontier of our platform.This is an exciting opportunity to work in a highly innovative environment with new technologies as we continue to extend our market leading position.

      Qualifications

      ABOUT YOU

      You are an engineer who can turn ideas into extremely reliable and scalable designs. You code in such a way that other engineers find your code easy to comprehend, modify, and build upon. You believe in the power of Integration and APIs to transform how systems are integrated and how applications are built.

      You will be successful in this role if you:

      • Enjoy helping and mentoring others around you as you grow and become a successful engineer and developer
      • Have excellent written and verbal communication skills
      • Are capable of working in a distributed team and able to excel in a remote culture
      • Are self-driven and able to work on key initiatives
      • Take pleasure in making things happen and listen to the input from peers
      • Are able to make data driven decisions
      • Are a believer in a best idea strategy regardless of where or who ideas come from

      We are looking for:

      • 5-8+ years of experience in building large scale distributed applications.
      • Strong experience building multi-tenant SaaS applications
      • Strong problem-solving, debugging, and analytical skills with great attention to detail
      • Experience with Microservices and Cloud-based architectures/design patterns

      Technical Skills and Experience:

      • Excellent JavaScript, CSS and HTML authoring skills.
      • Proficiency with Javascript, TypeScript, Java Node.js, or Go.
      • Familiar with application deployment via Docker and/or Kubernetes.
      • Hands-on experience with AWS services such as DynamoDB, S3, or CloudFront.
      • Bonus: Experience using DataDog APM and logging.
      • Bonus: Experience developing and releasing using CI/CD pipelines, such as GitHub Actions

      See more jobs at Jitterbit

      Apply for this job

      11d

      Full-Stack Software Engineering Intern

      MozillaRemote Canada
      sqlDesignapic++javascript

      Mozilla is hiring a Remote Full-Stack Software Engineering Intern

      Hiring Ranges:

      Remote Toronto: CAD 30.00 per Hour.

      To learn more about our Hiring Range System, please click thislink.

      Why Mozilla?

      Mozilla Corporation is the non-profit-backed technology company that has shaped the internet for the better over the last 25 years. We make pioneering brands like Firefox, the privacy-minded web browser, and Pocket, a service for keeping up with the best content online. 

      Now, with more than225million people around the world using our products each month, we’re shaping the next 25 years of technology. Our work focuses on diverse areas including AI, social media, security and more. And we’re doing this while never losing our focus on our core mission – to make the internet better for everyone. 

      The Mozilla Corporation is wholly owned by the non-profit 501(c) Mozilla Foundation. This means we aren’t beholden to any shareholders — only to our mission. Along with60,000+ volunteer contributors and collaborators all over the world, Mozillians design, build and distributeopen-sourcesoftware that enables people to enjoy the internet on their terms.

      About this team and role:

      Mozilla isn’t just a great place to work. It’s an experience you’ll carry with you throughout your career. As part of our internship program, you’ll have the opportunity to be mentored one-on-one by somebody brilliant, to impact the projects you’ll collaborate on, and to never be bored. Ever. From the passionate people you’ll learn from, to the chances you’ll have to make the Web a better place, your time with Mozilla will be unlike any other.

      We are hiring for multiple Firefox Fullstack teams - each solving their own unique challenges to make the web better for everyone. More details about all hiring teams will be shared in the interviews. 

      Below is a small snapshot of the work we do to give you an idea about some of the big things you could do at Mozilla.

      What you'll do:

      • Work on one of the world’s largest and most important open source codebases - the Firefox Desktop Browser.
      • Work with a world class engineering organization solving problems at internet skill. Your work will positively affect hundreds of millions of folks worldwide.
      • Write code and tests, build prototypes, tackle problems with no clear solution, collaborate with other designers and engineers to make the web a better place.
      • Learn about a wide variety of problems and solutions across a large, mature codebase.
      • Work with driven, committed team members to bring the open web to people around the world.

      What you'll bring:

      • You have experience with programming in JavaScript, HTML, and CSS. Knowledge of C/C++ and/or Rust is a plus.
      • Familiarity with SQL and relational databases is an asset.
      • Experience with API / Interface design 
      • You speak English fluently and enjoy conducting software engineering work in the open.
      • You are enrolled in a university and are available to come to our Toronto offices during regular working hours depending on your schedule.
      • You know how to identify a problem, come up with a logical solution, and use the knowledge to tackle similar problems in future.
      • You have an interest in and ability to work with a distributed team (which requires good asynchronous written communication skills as well as good verbal communication skills).
      • You are happy to provide and receive constructive feedback; when you see something that can be improved, you act on it.
      • You can build consensus on complex issues, through your empathy, internal credibility and visibility.
      • Unafraid of asking questions, and proposing new ideas if you think they will make a positive impact.
      • A love of helping your colleagues grow and get better at what they do.

      We value a variety of voices within our team and at Mozilla. You don't need to check every box on this list to apply.

      About Mozilla 

      When you work at Mozilla, you give yourself a chance to make a difference in the lives of web users everywhere. And you give us a chance to make a difference in your life every single day. Join us to work on the web as the platform and help create more opportunity and innovation for everyone online.  We’re not a normal tech company. The things we create prioritize people and their privacy over profits. We exist to make the internet a healthier,  happier place for everyone

      Commitment to diversity, equity and inclusion

      Mozilla believes in the value of diverse creative practices and forms of knowledge, and knows diversity, equity and inclusion are crucial to and enrich the company’s core mission. We encourage applications from everyone, including members of all equity-seeking communities, such as (but not limited to) women, racialized and Indigenous persons, persons with disabilities, persons of all sexual orientations, gender identities and expressions.

      We will ensure that qualified individuals with disabilities are provided reasonable accommodations to participate in the job application or interview process, to perform essential job functions, and to receive other benefits and privileges of employment, as appropriate. Please contact us at hiringaccommodation@mozilla.com to request accommodation.
       
      We are an equal opportunity employer. We do not discriminate on the basis of race (including hairstyle and texture), religion (including religious grooming and dress practices), gender, gender identity, gender expression, color, national origin, pregnancy, ancestry, domestic partner status, disability, sexual orientation, age, genetic predisposition, medical condition, marital status, citizenship status, military or veteran status, or any other basis covered by applicable laws. Mozilla will not tolerate discrimination or harassment based on any of these characteristics or any other unlawful behavior, conduct, or purpose.
       
      Req ID: R2337

      See more jobs at Mozilla

      Apply for this job

      11d

      Full-Stack Software Engineer (PHP/ReactJS)

      LoyaltekBrussels, BR Remote
      5 years of experiencelaravelDesignapipostgresqlmysqlAWSjavascriptbackendfrontendPHP

      Loyaltek is hiring a Remote Full-Stack Software Engineer (PHP/ReactJS)

      Full-Stack Software Engineer (PHP/ReactJS)

      Location: Brussels (Hybrid or Remote) Status: Freelancer Starting: ASAP

      Giftify is a FinTech/MarTech scale-up leader in turn-key Gift Card solutions for Shopping Centres and retailers across Europe. Our goal is to become the world leader in our industry.

      Through our Gift Card products, our passion is to bring efficient and innovative solutions to allow Shopping Centres and Retail Parks to raise and revolutionize their marketing strategy 'one gift card at a time'.

      Your mission, should you choose to accept it

      We are seeking a passionate Full-Stack Software Engineer to join our team. The ideal candidate will have a strong background in translating complex problems into simple and reliable code. As a key member of our team, you will be responsible for analyzing and implementing new features within our application from both frontend and backend perspectives. This includes areas such as payment processing, API endpoints, tokenization, virtual cards, administration tools, graphics, and reports.

      Responsibilities

      • Develop and implement new features across frontend and backend systems.
      • Collaborate with the team to ensure high-quality code and efficient performance.
      • Contribute to the continuous improvement of development processes and best practices.
      • Assist in bug fixing and troubleshooting to maintain system reliability.
      • Share knowledge and mentor colleagues to enhance team capabilities.

      Mandatory hard skills

      • Minimum 5 years of experience in a similar role.
      • Proficiency in PHP 8.2 with modern features such as types and annotations.
      • Strong expertise in Laravel 10, including cache, queues, Eloquent ORM, and Laravel Passport.
      • Mastery of React, JavaScript, and TypeScript.
      • Knowledge of ReactNative is a plus.

      The 5-legged goat (or assets)

      • Experience with testing strategies such as unit testing, integration testing, and TDD.
      • Proficiency in RESTful API design using tools like OpenAPI and Postman.
      • Familiarity with relational databases like MySQL or PostgreSQL, including optimization and design.
      • Collaborative development using pull requests.
      • Familiarity with CI/CD, DevOps, IaC, AWS is advantageous.

      Soft skills

      • Proficient written and oral English communication (level B2 or above).
      • Strong team player comfortable with pair programming.
      • Ownership and accountability for work delivered.
      • Ability to share knowledge and expertise with the team.

      Even if you're not a Superhero

      Don't meet every requirement? Don't hesitate to apply! We value diverse experiences and perspectives, and we're committed to adding new talent to our team.

      Recruitment process

      • Stage 1: Initial meeting with our recruiter to assess suitability.
      • Stage 2: Technical exercise to demonstrate skills.
      • Stage 3: Presentation of solution to Technical Director for further discussion and alignment.

      Join us in revolutionizing the Gift Card industry and shaping the future of marketing strategies. Apply now and be part of our exciting journey!

      See more jobs at Loyaltek

      Apply for this job