Full stack software engineer Remote Jobs

119 Results

25d

Senior Full Stack Engineer

TruebillSan Francisco, CA, Washington, D.C., New York City, N.Y., Remote (USA)
postgresDesigngraphqlc++postgresqltypescriptbackend

Truebill is hiring a Remote Senior Full Stack Engineer

ABOUT ROCKET MONEY ????

Rocket Money’s mission is to empower people to live their best financial lives. Rocket Money offers members a unique understanding of their finances and a suite of valuable services that save them time and money – ultimately giving them a leg up on their financial journey.

ABOUT THE TEAM ????

Team Insight's mission is to support the personal finance features that make Rocket Money an integral part of our members’ everyday financial journey. Whether it’s tracking their spending, analyzing their recurring bills and subscriptions, or managing their transactions, Team Insight’s goal is to build incredible interfaces (and the backend services that power them) that make it easy for our members to understand their financial habits.

Team Insight owns the core personal finance features that all of our members use. If you’re excited about building highly scalable features that work on the scale of millions of monthly active users, this is the team for you.

IN THIS ROLE, YOU'LL:

  • Work alongside a team to implement, iterate, and debug product features that drive forward both the company and the user.
  • Own projects from end to end, making key decisions in the implementation of new features that balance technical concerns with business concerns.
  • Develop with TypeScript across the stack, building user interfaces using React Native and the backend support required to power them with Node & GraphQL.
  • Be a steward of good user experience, ensuring that the interfaces we present our users are performant, understandable, and delightful.
  • Help to maintain our high technical bar, participating in code reviews and design discussions to ensure that we're applying appropriate rigor to our software development process.
  • Develop an understanding of our users to build and measure features which help them better understand and improve their finances.

ABOUT YOU ????

  • You have 5+ years of professional experience working with some combination of Node/TypeScript, React, GraphQL, and Postgres (or similar relational database).
  • You're both a student and a teacher, continually seeking to grow as an engineer and help those around you grow as well.
  • You're not just interested in what you're building, but also why you're building it. You want to see the bigger picture of how the software you're building is benefitting our users.
  • Experience with our stack (TypeScript, React Native, PostgreSQL) is a plus.
  • You understand observability and enjoy digging into the details to solve performance and user experience issues.
  • You thrive in a growing organization, and are not afraid of a challenging problem. In fact, you confront problems head on and take the lead on the solution.

WE OFFER ????

  • Health, Dental & Vision Plans
  • Competitive Pay
  • Matching 401k
  • Unlimited PTO
  • Lunch daily
  • Snacks & Coffee 
  • Commuter benefits

Additional Information: Salary range of $150,000 - $185,000/year + bonus + benefits. Base pay offered may vary depending on job-related knowledge, skills, and experience.

Rocket Money is an Affirmative Action and Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, or protected veteran status and will not be discriminated against on the basis of disability.

Pursuant to the San Francisco Fair Chance Ordinance, we will consider for employment qualified applicants with arrest and conviction records.

See more jobs at Truebill

Apply for this job

27d

IOT Full Stack Engineer

MetioraMadrid, Spain, Remote
sqlXamarinmongodbazurescrumiosgitjavac++androidpythonAWSfrontend

Metiora is hiring a Remote IOT Full Stack Engineer

Descripción del empleo

Estamos buscando a un/a #excepcional IOT Full stack engineer ???? que sea capaz de entender los retos de nuestros clientes, hacerlos suyos y que nos ayude a establecer relaciones a largo plazo con ellos, garantizando el éxito y la ejecución de los proyectos.

¿Qué esperamos de tu perfil profesional? 

  • Grado en Computer Science, Telecomunicaciones o electrónica
  • Al menos 2 años de experiencia en proyectos reales
  • Proactividad y pasión por la tecnología
  • Ganas de trabajar en equipo
  • Curiosidad intelectual y persistencia para resolver problemas

 

Requisitos

Necesitamos????

  • Experiencia desarrollo, diseño y prototipo de hardware y electrónica (Arduino, Raspberry Pi, Intel IoT Platform, PICs, Zigbee)
  • Experiencia con redes de comunicación y protocolos: TCP/IP, HTTP, FTP, MQTT 
  • Experiencia con entornos cloud (Azure, AWS, GCP)
  • Lenguajes de programación: Python, C#
  • Enfocado en la calidad, escalabilidad y código limpio
  • Bases de datos (SQL y derivados)
  • Web frontend (Django / Celery)
  • Metodologías ágiles (SCRUM)
  • Bases de datos no relacionales (MongoDB / Redis / Clickhouse)
  • Pruebas unitarias e integración continua
  • Experiencia con control de versiones (SVN / GIT)
  • Buen nivel de inglés

Valorable????

  • Experiencia con interfaces inalámbricas: 802.15.4, LoRaWAN, Bluetooth, BLE 4.0, WiFi, 3G, GPS, RFID
  • Experiencia con arquitecturas de bus digitales e interfaces (RS-232, USB, UART, CAN-Bus)
  • React/Node.JS
  • Desarrollo de aplicaciones móviles (iOS & Android con Xamarin)
  • C++, Java
  • Experiencia colaborando en proyectos Open Source
     

See more jobs at Metiora

Apply for this job

27d

Senior Software Engineer, Full-stack

TaniumRemote, Canada
agileBachelor's degreesalesforceDesigngraphqlapigitrubyjavac++jenkinspythonbackendNode.js

Tanium is hiring a Remote Senior Software Engineer, Full-stack

The Basics

As a Senior Software Engineer at Tanium, you will build and maintain best-of-breed products as part of a nimble development team. Tanium focuses on a customer engagement model and feedback process to ensure our products are designed the right way from the beginning. When new products ideas are identified, our software engineers design, develop, test, and deploy the products from the ground up, while iterating with product management and customers for feedback and input.

What you'll do

  • Build and maintain Tanium's products alongside an agile development team
  • Design, develop and test new product ideas from the ground up while working with product management for feedback and input
  • Work on small teams that tackle big challenges in common components like a common data service tasked with unifying and consolidating endpoint data across the entire ecosystem, handling time series data that drive dashboarding and reporting, and exposing data externally through GraphQL enabling partners (like Salesforce) to easily integrate
  • Delivering higher level services enabled by our core services that directly enable our products and focus on everything from security to operations to auditing

 

Education

  • Bachelor's degree or equivalent experience
  • CS Degree preferred

Experience

  • 5+ years industry experience
  • Experience designing and building high-impact, high-performance, scalable, observable, and maintainable backend services and APIs 
  • Knowledge of at least one of Golang (preferred), Node.js, Python, Ruby, Rust, or Java
  • Experience with HTTP API design and development
  • Experience with modern software engineering development and automation tools like git and Jenkins

Other

  • Demonstrates sound judgment for balancing between rapid development, long-term code maintainability and supportability
  • Believes in the power of and the need for writing automated tests as part of development
  • Experienced debugger who can put out fires under pressure when things go wrong in production environments
  • Has knowledge of a variety of modern software frameworks (server side & browser side) and the versatility to learn new tools

About Tanium 

Tanium, the industry’s only provider of converged endpoint management (XEM), leads the paradigm shift in legacy approaches to managing complex security and technology environments. Only Tanium protects every team, endpoint, and workflow from cyber threats by integrating IT, Operations, Security, and Risk into a single platform that delivers comprehensive visibility across devices, a unified set of controls, and a common taxonomy for a single shared purpose: to protect critical information and infrastructure at scale. Tanium has been named to the Forbes Cloud 100 list for six consecutive years and ranks on Fortune’s list of the Best Large Workplaces in Technology. In fact, more than half of the Fortune 100 and the U.S. armed forces trust Tanium to protect people; defend data; secure systems; and see and control every endpoint, team, and workflow everywhere. That’s the power of certainty. Visit www.tanium.com and follow us on LinkedIn and Twitter.

On a mission. Together. 

At Tanium, we are stewards of a culture that emphasizes the importance of collaboration, respect, and diversity. In our pursuit of revolutionizing the way some of the largest enterprises and governments in the world solve their most difficult IT challenges, we are strengthened by our unique perspectives and by our collective actions.   

We are an organization with stakeholders around the world and it’s imperative that the diversity of our customers and communities is reflected internally in our team members. We strive to create a diverse and inclusive environment where everyone feels they have opportunities to succeed and grow because we know that only together can we do great things. 

Each of our team members has 5 days set aside as volunteer time off (VTO) to contribute to the communities they live in and give back to the causes they care about most.   

What you’ll get

The annual base salary range for this full-time position is C$95,000 to C$280,000. This range is an estimate for what Tanium will pay a new hire. The actual annual base salary offered may be adjusted based on a variety of factors, including but not limited to, location, education, skills, training and experience.

 

 

For more information on how Tanium processes your personal data, please see our Privacy Policy.

See more jobs at Tanium

Apply for this job

27d

Tech lead Full Stack

DevoteamRabat, Morocco, Remote
agileDesignmongodbsassgitjavadockerpostgresqlmysqltypescriptcsskubernetesangularAWSjavascript

Devoteam is hiring a Remote Tech lead Full Stack

Description du poste

LES MISSIONS DU DEVELOPPEUR FULL-STACK JAVA/ANGULAR

  • Vous interviendrez sur les nombreux projets et problématiques de nos clients,
  • Vous participerez activement aux phases projet (analyse/développement, mise en place
    et livraison) en proposant des solutions.
  • Vous réaliserez “from scratch” des projets,
  • Vous adresserez les problématiques d’architecture, de testabilité, de maintenabilité en
    proposant des solutions,
  • Nous partagerons les bonnes pratiques et sujets innovants quotidiennement,
  • Nous apprendrons grâce à vous et vous apprendrez de nous,
  • Vous participerez à la vie du pôle web (BBL, crossDT, soirée technique, …),

LE CADRE DU DEVELOPPEMENT FULL-STACK JAVA/ANGULAR

  •  Java 10+ (Spring Boot, Spring Security, Spring JPA, Spring Data, Maven, Gradle), J2EE,Hibernate.
  • JavaScript (TypeScript, Angular 6+), SASS, Karma, Jasmine.
  • PostgreSQL, DynamoDB. MongoDB, MySQL, MS Server, H2.
  • AWS, Google Cloud, Microsoft Azure.
  • Git, Docker (Swarm, Rancher, Kubernetes, Compose).
  • Architecture SOA, WOA, Microservices.
  • Nous opérons dans un cadre de Devops (CI/CD), de la manière la plus agile possible.

Qualifications

De formation Bac+5, d’une École d’Ingénieur ou équivalent, tu es non seulement capable d’apprendre et de réaliser des développements en technologies web innovantes mais aussi de comprendre, débugger et maintenir des bases de code moins récentes.

Tu sais prendre du recul sur tes réalisations et celles de tes collègues, ainsi que proposer et mettre en places des améliorations. La qualité, la robustesse, l’optimisation et les performances, ainsi que la précision de l’interface sont des concepts qui importent pour toi.

Nous recherchons des personnes ayant déjà +5 années d’expérience en développement Java et Angular, ainsi qu’en intégration graphique & responsive design (HTML, CSS), et qui ont l’envie d’intervenir sur des projets ambitieux et de partager leur passion.

Alors si tout ceci te correspond, si tu souhaites progresser et produire, apprendre et partager, rejoins-nous !

See more jobs at Devoteam

Apply for this job

29d

Senior Full Stack Software Engineer - Cloud Applications

JitterbitSão Paulo, Brazil, Remote
DesignapijavadockerelasticsearchmysqltypescriptcsskuberneteslinuxangularAWSjavascriptNode.js

Jitterbit is hiring a Remote Senior Full Stack Software Engineer - Cloud Applications

Job Description

Jitterbit is seeking a Senior Full Stack Software Engineer to join our Cloud Applications team. Jitterbit is an iPaaS (Integration as a Service) and API Management platform who has been recognized in the leader quadrant of Gartner for five straight years. Our customers use our iPaaS and APIM platform to solve mission critical business problems. What is our challenge? To make it easy to integrate our customers’ systems. In order to do this, we need to build and create a SaaS offering that is reliable, stable, and scalable for our customers. Do you have the design, architecting, and code-writing capabilities to take on this challenge? And can succeed in a big way?

ABOUT THE TEAM

The engineering team at Jitterbit believes that the quality of our code reflects directly on us as professionals. We are relentless about crafting a product that is innovative and delivers a memorable user experience; an experience that is fast and robust. As a key engineer on our team, you will collaborate with other engineers, product management, and operations. Our culture is fun, fast-paced, performance-oriented, open, and collegial. We are constantly pushing the technology envelope to the edge! We are very distributed and our culture is set up to make all of us very effective working remotely. We believe in hiring talent where it exists.

ABOUT THE JOB

You will be helping us build, design, and architect awesome and new capabilities on our various Cloud Application products. We are looking for a senior full stack engineer. You will be working with Angular, TypeScript, Node.js, CSS3, Nginx, Tomcat, Kafka, Elasticsearch, MySQL, Linux, Docker, and Kubernetes; to name a few of the technologies we use in our Cloud Apps team. You will have full lifecycle responsibilities to create robust, scalable, and distributed systems that operate flawlessly 24x7x365. You will have an opportunity to learn new things. We’re always expanding into new areas, exploring new technologies and pushing the frontier of our platform.This is an exciting opportunity to work in a highly innovative environment with new technologies as we continue to extend our market leading position.

Qualifications

ABOUT YOU

You are an engineer who can turn ideas into extremely reliable and scalable designs. You code in such a way that other engineers find your code easy to comprehend, modify, and build upon. You believe in the power of Integration and APIs to transform how systems are integrated and how applications are built.

You will be successful in this role if you:

  • Enjoy helping and mentoring others around you as you grow and become a successful engineer and developer
  • Have excellent written and verbal communication skills
  • Are capable of working in a distributed team and able to excel in a remote culture
  • Are self-driven and able to work on key initiatives
  • Take pleasure in making things happen and listen to the input from peers
  • Are able to make data driven decisions
  • Are a believer in a best idea strategy regardless of where or who ideas come from

We are looking for:

  • 5-8+ years of experience in building large scale distributed applications.
  • Strong experience building multi-tenant SaaS applications
  • Strong problem-solving, debugging, and analytical skills with great attention to detail
  • Experience with Microservices and Cloud-based architectures/design patterns

Technical Skills and Experience:

  • Excellent JavaScript, CSS and HTML authoring skills.
  • Proficiency with Javascript, TypeScript, Java Node.js, or Go.
  • Familiar with application deployment via Docker and/or Kubernetes.
  • Hands-on experience with AWS services such as DynamoDB, S3, or CloudFront.
  • Bonus: Experience using DataDog APM and logging.
  • Bonus: Experience developing and releasing using CI/CD pipelines, such as GitHub Actions

See more jobs at Jitterbit

Apply for this job

+30d

Specialist, Full Stack Developer II

Team RubiconLos Angeles, CA OR Remote
sqlDesignhtml5qac++.netangularjavascriptbackendfrontend

Team Rubicon is hiring a Remote Specialist, Full Stack Developer II

Team Rubicon (TR)is seeking aSpecialist, Full Stack Developer II. TheFull Stack DeveloperIIwill workalongsidethe rest of the Technology Department to build and updatecustom tools and products to enable Team Rubicon’s missionon a daily basis. This will requirethe ability to collaborate, plan, and execute as well asdemonstratedskills in software design andimplementation.TheFull Stack Developer IIwillbe responsible foradvanced configuration, development, implementation, testing, and deployment of web-based applications, business intelligence solutions, and integration of applications and data. 

Evey day will be a challenge, but every month brings new opportunities for an organization that is quickly becoming a household name in disaster response. This position reports to TR’sManager, Business Applicationsand is based out of TR’s National Headquarters in Los Angeles, CA or remote within the United States.

Duties: 

  • Software Development: Design, develop, andmaintainscalable web applications using .NET Core, Angular, and SQL technologies. 
  • Frontend Development: Implement user-friendly interfaces and user experiences using Angular framework, HTML5, CSS3, and JavaScript. 
  • Backend Development: Create robust APIs and backend services using .NET Core framework for seamless integration with frontend components. 
  • Database Management: Design andoptimizeSQL database schemas, write complex queries, and ensure data integrity and security. 
  • Code Reviews and Testing:Participatein code reviews to ensure code quality, conduct unit tests, and contribute to the overall software testing process. 
  • Documentation: Document technical specifications, architectural designs, and code implementation details for future reference and collaboration. 
  • Collaboration: Work closely with cross-functional teams including UI/UX designers, product managers, and QA engineers to deliver high-quality software solutions. 
  • Problem Solving: Troubleshoot and debug issues,identifybottlenecks, and implement effective solutions tooptimizeapplication performance. 
  • Continuous Improvement: Stay updated with industry trends, emerging technologies, and best practices in software development. Propose and implement process improvements to enhance team productivity and software quality. 

Experience and Background:

  • Minimum of 3-5 years of professional experience in software development. 
  • Strong understanding of software development principles, design patterns, and best practices. 
  • Experience with version control systems such as Git and collaborative development tools like JIRA. 
  • Familiarity with RESTful API design and implementation, as well as microservices architecture. 
  • Soft Skills: 
    • Excellent communication and collaboration skills with the ability to work effectively in a team environment. 
    • Self-motivated with a proactive approach to learning and skill development. 

Special Requirements: 

  • This is a full-time, hybridrole based in Los Angeles, CA(with the potential to be a remote role based anywhere within the United States) and provides a flexible & non-traditional work schedule (relocation expenses not provided).
  • This role alsoEveningand weekend schedule supporting operations and tech team[Additional requirements such as evening/weekend schedule requirement and local/other travel requirements].
  • Travel: At least 15% travel for in-person design sessions and meeting with stakeholders.

Job Type:  

  • Full-time, salary, exempt 

Job Tier:  

  • Specialist 

Pay Range: 

  • $80,514.00 – $137,241.60 per year 

Cultural Principles:   

  • Mission First, Greyshirt Always: Anyone joining TR must understand that our mission to provide disaster response comes first 
  • Step into the Arena: TR needs leaders who aren’t afraid to dare to be great  
  • Everyone Has A Role Know It: Ability to successfully navigate a fast-paced, high-growth environment and solve problems in the face of ambiguity 
  • GSD: We are entrepreneurial, resourceful and determined no matter how chaotic the situation 
  • Change Your Socks: We take care of ourselves and each other so we are best equipped to serve those in greatest need 
  • Adults Only: Every team member is an adult until proven otherwise 
  • Your Mother’s A Donor: Every leader must be committed to fiduciary responsibility, transparency and financial stewardship 

Perks of the Team:   

  • Unlimited Flexible Paid Time Off  
  • Generous holiday schedule (including a paid week off between winter holidays)  
  • Matching 401k contributions up to 4% with no vesting requirement 
  • 100% company-paid health benefits for employees and their dependents  
  • Professional development, leadership development and events/conferences 
  • Paid time off to volunteer with the non-profit of your choice 
  • One-week all-inclusive onboarding experience 

The health of our staff and volunteers is a top priority for Team Rubicon. We require all new employees to be fully vaccinated against COVID-19 or to obtain an approved exemption as an accommodation. If you are not willing to be vaccinated, your offer will be rescinded unless Team Rubicon approves a valid exemption and reasonable accommodation for qualifying religious or medical reasons (or for other categories protected by applicable law. This policy is intended to comply with all state and local laws, including all applicable equal employment opportunity laws. 

Learn more about Team Rubicon: 

Team Rubicon is an equal opportunity employer and is committed to not only including but actively seeking out a diversity of lifestyles, experiences, perspectives, and voices in order to foster inclusion, growth, and innovation. Your candidacy will be considered without regard to race, color, religion, gender, gender identity or expression, sexual orientation, national origin, genetics, disability, age, or veteran status. 

See more jobs at Team Rubicon

Apply for this job

Consensys is hiring a Remote Senior Fullstack Engineer (Infura)

Job Application for Senior Fullstack Engineer (Infura) at Consensys

See more jobs at Consensys

Apply for this job

+30d

Fullstack Technical Lead

In All Media IncArgentina Remote
agilesqlDesignazurec++.nettypescriptcssangular

In All Media Inc is hiring a Remote Fullstack Technical Lead

Fullstack Technical Lead

In All Media

About the Client:

Global technology and engineering company dedicated to delivering innovative solutions to our customers in the Life Sciences industry. As part of our commitment to excellence, we are seeking a talented Tech Lead to support our software development capabilities and lead the replacement of our current ActivePDF solution with a customized, cost-effective alternative. This is an exciting opportunity to significantly impact the client and its customers by delivering cutting-edge software solutions.

We are looking for a highly skilled Tech Lead to join our Life Sciences group and lead the development of a customized, royalty-free alternative to our current ActivePDF solution. The successful candidate will have extensive experience in software development, strong leadership skills, and a passion for driving innovation. As the Tech Lead, you will be responsible for leading a team of developers, defining technical architecture, and ensuring the successful delivery of high-quality software solutions.

Key Responsibilities:

  • Lead the software development team in the design, development, and implementation of a customized, cost-effective alternative to our current ActivePDF solution.
  • Define technical architecture, design patterns, and coding standards to ensure scalability, reliability, and maintainability of the software solution.
  • Collaborate with product owners, business stakeholders, and cross-functional teams to gather requirements, define project scope, and prioritize tasks.
  • Mentor and coach team members on coding best practices, software development methodologies, and emerging technologies.
  • Drive continuous improvement and innovation by identifying opportunities for process optimization, automation, and tooling enhancements.
  • Ensure adherence to coding best practices, version control, build, deployment, and test management processes.
  • Monitor project progress, identify risks and issues, and implement mitigation strategies to ensure successful project delivery.
  • Act as a technical liaison between the development team and other stakeholders, providing guidance and support as needed.

Requirements:

  • Strong communication (verbal and written) and interpersonal skills.
  • Proven ability to work autonomously and as part of a collaborative team.
  • Demonstrated experience developing software in an organization using the Scaled Agile Framework (SAFe).
  • Familiarity with coding best practices, design patterns, and software development lifecycle methodologies.
  • Proficiency in Windows, Angular (10 and above), Typescript, HTML, CSS, C#, .NET Framework 4.1 and above (ASP.Net, MVC, MVVM), .Net Core 3.0 and above, Azure (CI/CD), SQL, and GIT.
  • 10+ years of experience in software development, including 4+ years in a technical leadership role.
  • Nice to have: Familiarity with Windows Log (nLogger), knowledge of self-signed certificates, and experience with Active PDF.

Benefits:
100% remote work.
Payments made from the US.
International teams.
Exciting projects; all our clients are top-notch US-based companies.
Hourly rates in US dollars.
Full-time and long-term projects.
Contract as a vendor.

See more jobs at In All Media Inc

Apply for this job

+30d

Senior Fullstack Engineer

carsalesSydney, Australia, Remote
terraformairflowvuetypescriptangularbackendfrontendNode.js

carsales is hiring a Remote Senior Fullstack Engineer

Job Description

What you will do

We're hiring a Senior Full-stack Engineer (frontend focus) who will join a team of talented developers, continuing to work with our wider Tech and Product teams and clients. 

This is an exciting role, which will include:

  • You'll work in cross-functional full-stack team which prioritises software craftsmanship.
  • You'll have opportunities to work on all aspects of the product, including frontend (Vue.JS), backend (Nest.JS) , CI/CD (CircleCI), Cloud (Terraform + GCP), Data Engineering (Airflow, BigQuery, Apache Beam)
  • Your work will have a real impact on the business and our clients, including Weatherzone, the NRL, and OzBargain.

Qualifications

What you bring to the role

  • A good understanding of frontend engineering
  • An interest in User Experience, and a willingness to understand what the end-user is trying to achieve
  • Proficient with Typescript
  • Strong knowledge of Node.js REST APIs to read and understand the code, and make basic changes.
  • experience with modern frontend frameworks (Vue, React, Angular, etc) is essential.
  • Professional experience with Vue will be a significant advantage.

See more jobs at carsales

Apply for this job

+30d

Senior Software Engineer (Full Stack)

Procore TechnologiesBangalore, India, Remote
postgresDesignUXrubyjavatypescriptbackendfrontend

Procore Technologies is hiring a Remote Senior Software Engineer (Full Stack)

Job Description

What if you could use your technology skills to develop a product that impacts the way communities’ hospitals, homes, sports stadiums, and schools across the world are built? Construction impacts the lives of nearly everyone in the world, and yet it’s also one of the world’s least digitized industries, not to mention one of the most dangerous.

That’s why we’re looking for an experienced Senior Full-Stack Software Engineer to join Procore’s journey to revolutionize a historically underserved industry. In this role, you’ll join our highly collaborative Product and Engineering organization to drive the technical direction of our projects.

This position will report to a member of our Engineering Management team and has the opportunity to work hybrid from the Bengaluru or Pune office. We’re looking for someone to join our team immediately.

What you’ll do:

  • Develop mission-critical systems using Java, Ruby, React and Postgres
  • Contribute to designing and building a system that is aligned with Procore’s technical vision of a service-oriented architecture
  • Work up and down the stack to ship code for our Rails backend and our React frontend, and dive deep into the database layer to handle complex querying needs
  • Collaborate with Engineering, Product, and UX to design and build solutions that delight users and solve critical business problems
  • Develop teammates by conducting code reviews, providing mentorship, pairing, and training opportunities
  • Serve as a subject matter expert in a domain, including processes and software design that help guide others to create and maintain a healthy codebase

What we're looking for:

  • Bachelor’s Degree in Computer Science, a related field, or comparable work experience
  • 5+ years experience in Object-Oriented Program fundamentals, Test Driven Development and Design principles (Java, Ruby, React, Typescript)
  • Experience designing and building software in a Service-Oriented Architecture
  • Track record of anticipating technical problems that will fall out of major projects and designing solutions to overcome those problems
  • Demonstrated expertise in building and/or significantly improving large features, supporting technological areas, and architecture initiatives
  • Experience working with our stack of Java, React, and Postgres
  • Strong experience documenting and bringing team clarity to complex solutions
  • Time-honed expertise with modern web development across the entire spectrum of development, testing, staging, deploying, and monitoring
  • A curious mind that is driven to innovate and solve customer problems

Qualifications

See more jobs at Procore Technologies

Apply for this job

+30d

Full Stack Software Engineer (Mid-Level)

Property MeldUnited States Remote
remote-firstnosqlDesigntypescriptpython

Property Meld is hiring a Remote Full Stack Software Engineer (Mid-Level)

Software Engineer

Welcome to the future of property maintenance! Property Meld’s vision is to radically improve how the property management industry handles maintenance. If you’ve ever had a maintenance issue at your housing rental, you know how much of a pain it can be to get it fixed quickly and reliably. Join Property Meld and help solve the maintenance headache!

We’re a small company but our growth potential is huge! Recognized as one of the fastest-growing startups in property management, we are looking for a motivated software engineer who wants to have an immediate impact on our journey.

Your Role
As a software engineer, you will tackle difficult engineering problems while developing and shipping new features for our product, ensuring that they are performant, scalable, and well-engineered. The Property Meld services are used by hundreds of thousands of people and dozens of partners. You will help scale Property Meld’s services by developing new web app features, improving our CI/CD processes, profiling and fixing performance issues, and solving technical challenges in a collaborative team environment. We’re looking for someone who:

  • Can ship software with exceptional quality in a high-velocity team
  • Has experience in some or all of the following: Python, Typescript, Django, React, and various data stores (relational databases, NoSQL databases)
  • Can solve problems without adding accidental complexity
  • Can take ownership of projects and architect them from the ground up to be scalable, maintainable, and elegant in design
  • Is an expert in at least one area of building web applications and proficient in other areas
  • Has a bias for action
  • Has 5+ years of professional software development experience
  • Experience operating the infrastructure of a public-facing web site preferred

We recognize that good engineers can learn any technology so don’t hesitate to apply if your background is in other technologies. Our focus is on delivering an amazing product at an impressive rate to our customers.

What you’ll get

  • A remote work environment and a work laptop of your choice.
  • Great work-life balance
  • The chance to build and scale out an ambitious project
  • A team environment with a culture of execution
  • Involvement in the decision-making process
  • Great teammates that care about your success
  • A chance to help solve the headache that is maintenance for millions of people

About Our Pay and Benefits

The salary range for this position is

$100,000 - $145,000

*Candidates MUST be eligible for full-time employment in the United States.

The product team at Property Meld is a remote-work organization. We require 4 hours of overlap time, daily, with the Mountain Time Zone. The position is 99% remote, with the following non-pandemic exceptions: Once a year, the total company gets together for a week of getting to know each other and to better understand the big picture of the company and how we work in each department and role. Two times per year the product team gets together in the same physical location to get to know each other better and work through interesting challenges together. In addition, once a quarter, on your schedule, you are expected to visit with a customer and shadow them to learn how they are using and not using our product.

We value diverse points of view and know that our differences make us stronger. We believe in fostering a place to work that is open, welcoming, diverse, inclusive, and healthy. We strongly encourage applications from individuals who are under-represented in the tech industry, across color, creed, race, ethnic and national origin, physical ability, gender, sexual identity, or any other basis.

Our benefits package is designed to be a part of our employees’ story of living well. We believe in our culture of trust and respect, where we have reasonable working hours, vacation time used for rejuvenation, employee wellness & health, and employee development,

  • Healthcare through Wellmark Blue Cross Blue Shield
  • Dental through Beam
  • Vision through Beam
  • 401K through Guideline
  • $25,000.00 Life Insurance Policy sponsored by Property Meld
  • Four Weeks PTO annually, and allotted upon hire
  • Employee Equity Options Program
  • Personalized Remote Work Equipment. You select what equipment will work best for you.
  • Travel Opportunities
  • Meetups with the company 1-3 times a year


*Candidates must be eligible for full-time employment in the United States.


See more jobs at Property Meld

Apply for this job

+30d

Fullstack Engineer

UserTestingBarcelona - Remote
Designc++typescriptkubernetesNode.js

UserTesting is hiring a Remote Fullstack Engineer

We’re UserTesting, a leader in experience research and insights; we believe the path to human understanding and great experiences start with a shared understanding—seeing and hearing how another person engages with the world around them and taking in their perspective. Working at UserTesting, you will be empowered to help organizations  discover the human side of business–transforming how they work, collaborate, innovate, and bring new products and experiences to market. This is what inspires us, and it’s how we enable companies to connect with their audiences naturally and organically through an experience that is uniquely, and intentionally human.

A trusted company by top brands for 15+ years, UserTesting, recently merged with UserZoom, has over 3,400 customers in 50 countries, including 75 of the Fortune 100 companies. Joining our team means being part of a passionate group focused on transforming how companies learn from and understand their customers. Come join us and help us build the engine for human understanding.

The Opportunity

As part of the Engineering Team, you will have a great opportunity to contribute to building on our SaaS platform. Working alongside our global team you will be responsible for creating something truly amazing - the Human Insights industry is an exciting place to be right now. As UserTesting grows, so does our focus on your career and personal development. More importantly, the team here at UserTesting is both supportive and welcoming of new team members, with plenty of social events (if you like to get involved).

The Team

The Engineering team is an integral part of our organization, with members spanning many global locations. We are committed to building effective solutions, delivering for impact, always learning, and iteratively shaping the Product to transform the business, while growing a state-of-the-art SaaS platform in a scalable and reliable way.

What you will be doing

  • Collaborate with the team to understand project requirements and translate them into clear, concise code.
  • Write, test, and debug code using a variety of programming languages.
  • Conduct unit testing to ensure code functionality and identify potential issues.
  • Contribute to code reviews, providing constructive feedback and learning from senior engineers.
  • Approach problem-solving with a proactive and independent attitude.
  • Document code clearly and concisely to ensure maintainability and collaboration.
  • Stay up-to-date with the latest software development trends and technologies.
  • Learn and adapt to new technologies as needed.
  • Assist with debugging and troubleshooting technical issues.
  • May participate in some aspects of system design and architecture (depending on project needs).
  • Great communication skills, able to understand and clarify complex matters with non-technical colleagues.

What we are looking for

  • Bachelor’s degree in computer science or equivalent.
  • You have strong technical skills and solid conceptual foundations.
  • Experience with Typescript, Node.js, and/or the React ecosystem.
  • You like Distributed Software, Microservices, and Event-driven Cloud Architectures.
  • You are familiar with or interested in learning some of our toolset: GraphQL/Apollo, gRPC, Kafka, Mongo, Kubernetes, GitHub Actions, SingleSpa, Jotai, Jest/Cypress.
  • You are in for the challenge of building highly reliable & scalable systems.
  • You are eager to learn, screen those learnings, and apply the best suited for a bounded context.
  • You have experience in discussing, spiking & benchmarking Engineering solutions.
  • You speak fluent English.
  • Familiarity with Reactive & Domain Driven Architectures.
  • Demonstrates UserTesting’s values through work product and within day-to-day team interactions.

What we offer

- Employee Assistance Program (EAP)
- Health Insurance
- Flexible retribution
- Employee Referral Program
- Professional Development Stipend
- Remote work stipend
- Wellness reimbursement 
- Volunteer days

To learn more about our team, culture, and customers, check out ourcareers page,company blog, andpress/awards. Aside from a great work environment and the opportunity to make an impact, we’re also growing the team quickly–join us!

At UserTesting, we are committed to providing more inclusive and accessible experiences for our candidates. We pride ourselves on building empathy; diverse perspectives, which we believe are the key values to creating exceptional experiences for everyone. Our commitment to providing accessible experiences is driven by this belief and our core values. If you require any accommodations or have any specific requests about how we could tailor our interview process to better suit your needs please contact us on:talentexperience@usertesting.com.If you need to speak to someone please ask!

******

UserTesting is an Equal Opportunity Employer and a participant in the U.S. Federal E-Verify program.  Women, minorities, individuals with disabilities and protected veterans are encouraged to apply.  We welcome people of different backgrounds, experiences, abilities and perspectives.  

UserTesting will consider qualified applicants with criminal histories in a manner consistent with the San Francisco Fair Chance Ordinance, as applicable.  

We welcome candidates with physical, mental, and/or neurological disabilities. If you require assistance applying for an open position, or need accommodation during the recruiting process due to a disability, please submit a request to People Operations by emailingaskPeopleOps@usertesting.com.

See more jobs at UserTesting

Apply for this job

+30d

Senior JAVA Full Stack Developer

MobicaWarsaw, Poland, Remote
agilenosqlsqloracleapijavadockermysqlkubernetesbackend

Mobica is hiring a Remote Senior JAVA Full Stack Developer

Job Description

Our Customer is a leading global provider of cutting-edge payments technology solutions, dedicated to shaping the future of financial transactions worldwide. With a commitment to innovation and excellence, we connect consumers, businesses, financial institutions, and governments in over 200 countries and territories through our advanced processing networks.

Currently we are looking for Senior Full Stack Developers within JAVA technology experienced in building Front End and Back End working in Agile environment.

This is a hybrid work opportunity, requiring attendance at the customer's office in Warsaw twice a week for team relationship-building purposes.

Due to the nature of our work in the financial market, candidates will be subject to detailed background screening including education, employment history, and criminal record.

Qualifications

Basic Qualifications:

  • 8 years of work experience with a Bachelor’s Degree or at least 6 years of work experience with an Advanced Degree (e.g. Masters/MBA/JD/MD) or at least 2 years of work experience with a PhD

Preferred Qualifications:

  • Experience with tools development, automation (CI/CD, Auto Deployment, System Availability, etc.).
  • Must have a solid understanding of latest backend technologies like gPRC, REST, JSON and other relevant API standards like OAuth, SAML.
  • Extensive technical experience with full stack HTTP, JAVA REST APIs, databases, Java frameworks at scale. goLang app development is an added bonus.
  • Experience with distributed async event streaming platform especially Kafka
  • Experience with both NoSQL and SQL datastores including Oracle, MySQL, Cassandra, MongoDB. Graph DB, especially neo4J experience is an added bonus.
  • Experience with large-scale active-active systems environments managed through Kubernetes and container (Docker) technologies
  • Extended experience in Agile Release Management practices, governance, and planning. 
  • Strong ability to build and sustain working and strategic relationships across technology. 
  • Experience within container space, understands and able to quickly build and drive team to support future systems.
  • Strong leadership skills with demonstrated ability to lead global, cross-functional teams.  Strong analytical and problem solving skills.
  • Ability to maintain composure under pressure and tight deadlines.
  • Ability to ensure quality of deliverables by participating in testing activities
  • Must have experience in debugging and troubleshooting in Linux/Unix/Container based application servers such as Tomcat, VertX, WebSphere, Docker, Kubernetes environments.
  • Good to have experience setting up test setup and strategy in cloud infrastructure & technologies.

See more jobs at Mobica

Apply for this job

+30d

Software Engineer II (Full stack)

agileremote-firstkotlinfigmapostgressqlDesignvuegraphqljavapythonbackendfrontend

Parsley Health is hiring a Remote Software Engineer II (Full stack)

About us:

Parsley Health is a digital health company with a mission to transform the health of everyone, everywhere with the world's best possible medicine. Today, Parsley Health is the nation's largest health care company helping people suffering from chronic conditions find relief with root cause resolution medicine. Our work is inspired by our members’ journeys and our actions are focused on impact and results.

The opportunity:

We’re looking for a full stack engineer and leader with knowledge of frontend and backend technologies that can and enjoys building exciting new features from zero to hero that support the Parsley Health mission. You will be joining a remote team of passionate engineers.  In this role, you will work closely with engineering, product, design, clinical, marketing, and customer reliability teams. Parsley Health is an outcome driven organization and your work will directly contribute to the company objectives:  expand the business nationally, improve activation, conversion, retention, and expansion of our healthcare products.

We work in a blameless environment and we take ownership and pride in our efforts. We follow agile development pvractices and encourage each pod to tailor the processes to their needs. Our teams are built on pillars of trust, humility and continuous improvement.

What you’ll do:

  • Take ownership of technical design and implementation by working directly with product, design, and stakeholders to build out new concepts or products
  • Partner with sr members of the team to gain feedback on technical design and code plus also assist with implementation on larger projects
  • Build modern, beautiful web applications that shape our members’ experiences, empower doctors and health coaches, and support our internal team
  • Work closely with our Design teams to design, spec and estimate new projects and features
  • Work as part of an amazing team of engineers while being a technical leader and mentor other team members
  • Foster high code quality, security and set best practices

What you’ll need:

  • A full stack engineer with 2+ years of experience
  • Have  1+ years of on-the-job experience in the following technologies:
    • Front-end frameworks: React, Next, Remix, Vue, or Svelte
    • Backend languages support web services: Python, Java, Go, Kotlin or NodeJS
    • SQL relational database
  • Have a exposure to microservice patterns, domain services and front-end applications
  • Have exposure to design systems, component libraries, and/or Figma
  • Experienced in unit testing
  • Be able to diagnose and remediate issues in existing systems
  • Someone who takes a disciplined approach to development, testing, documentation, code structure and review in a team environment
  • Be able to own the development and lifecycle of at least a smaller sized feature
  • Have an entrepreneurial mindset in venture-backed growth-stage startups
  • Passionate about our mission to live healthier through revolutionary primary care, excited for the future of healthcare, and a personal belief in wellness

Our tech stack:

  • GCP is our platform for all custom application development and services
  • Services are containerized and run in containerd
  • GraphQL is our service language for applications.
  • Current languages of choice are Golang (new services) and Kotlin (legacy).
  • Managed Postgres with Cloud SQL.
  • GitHub is our repository and CI/CD service.

Benefits and Compensation:

  • Equity Stake
  • 401(k) + Employer Matching program
  • Remote-first with the option to work from one of our centers in NYC or LA
  • Complimentary Parsley Health Complete Care membership
  • Subsidized Medical, Dental, and Vision insurance plan options
  • Generous 4+ weeks of paid time off
  • Annual professional development stipend

Parsley Health is committed to providing an equitable, fair and transparent compensation program for all employees.

The starting salary for this role is between $123,250 - $145,000, depending on skills and experience. We take a geo-neutral approach to compensation within the US, meaning that we pay based on job function and level, not location.

Individual compensation decisions are based on a number of factors, including experience level, skillset, and balancing internal equity relative to peers at the company. We expect the majority of the candidates who are offered roles at our company to fall healthily throughout the range based on these factors. We recognize that the person we hire may be less experienced (or more senior) than this job description as posted. If that ends up being the case, the updated salary range will be communicated with candidates during the process.


At Parsley Health we believe in celebrating everything that makes us human and are proud to be an equal opportunity workplace. We embrace diversity and are committed to building a team that represents a variety of backgrounds, perspectives, and skills. We believe that the more inclusive we are, the better we can serve our members. 


Important note:

In light of recent increase in hiring scams, if you're selected to move onto the next phase of our hiring process, a member of our Talent Acquisition team will reach out to you directly from an@parsleyhealth.comemail address to guide you through our interview process. 

    Please note: 

  • We will never communicate with you via Microsoft Teams
  • We will never ask for your bank account information at any point during the recruitment process, nor will we send you a check (electronic or physical) to purchase home office equipment

We look forward to connecting!

#LI-Remote

See more jobs at Parsley Health

Apply for this job

+30d

Senior Full Stack Engineer

Procore TechnologiesBangalore, India, Remote
sketchsqlDesignPhotoshopUXc++dockertypescriptcsskubernetespythonAWS

Procore Technologies is hiring a Remote Senior Full Stack Engineer

Job Description

As a Full Stack Engineer, you’ll focus on creating the common flexible core of our current and future Data platform, empowering internal and external teams to more efficiently create and deliver experiences on the Procore Data Platform. You’ll join our highly collaborative Product and Engineering organization to drive the technical direction of our projects. You’ll refine standards for development teams and tackle initiatives in partnership with Product, UX/Design, and other internal teams and groups. If you’re looking for the chance to have a significant impact that extends beyond the boundaries of your team—we have just the job for you!

What you’ll do:

  • Design, implement, test and deliver highly scalable web based products 
  • Write a highly performant code that minimizes payload size and deferred scripts while consuming the lowest possible amount of browser resources and high-quality code in a Test Driven Development environment (Jest, react-testing-library, cypress)
  • Create, maintain, and contribute to a custom framework and component library built in React
  • Develop fellow teammates by conducting code reviews, providing mentorship, pairing, and training opportunities
  • Leverage a customer-centric approach to lead architectural design decisions that improve scalability and performance for users
  • Build capabilities to ingest and visualize data from diverse data sources 
  • Collaborate with the data team to design and develop data driven web applications that would include complex data visualizations used  for KPIs, internal metrics etc.
  • Work closely with a team of engineers, product managers, and UX experts
  • Develop test strategies, work with test automation frameworks, write unit/functional tests to drive code coverage and automation metrics

What we're looking for:

  • Bachelor’s Degree in Computer Science, a related field, or comparable work experience
  • 5+ Years of experience in building and managing web based applications at large scale. 
  • 5+ years experience with JavaScript. Additional preference with modern libraries and frameworks (React preferred)
  • Proven experience with web tooling like HTML, CSS, Webpack, Jest, NPM, Typescript, etc.
  • Strong experience building complex web based data visualizations and data interactive objects using frameworks such as D3.js, Chart JS, Highcharts, Grafana, Kibana etc.
  • Experience with tools for data analytics (SQL, Python or R a plus), containers (Docker & Kubernetes), Web Content Accessibility Guidelines (WCAG 2.0), and component libraries such as MUI
  • Familiarity with Adobe CC Photoshop & Illustrator, Sketch, and other editing and layout tools
  • Experience leading initiatives, understanding the tradeoffs between technical, analytical, and product goals and are adept at formulating solutions that satisfy all of these needs, course-correcting as needed
  • Experience working with asynchronous requests in large scale applications and developing RESTful APIs
  • Experience working with various cloud based and distributed database systems and data services such as Snowflake, AWS, Databricks
  • Proven expertise with modern web development, including development, testing, staging, deploying, and monitoring
  • Ability to consistently evaluate current technical approaches to continue to be industry best-of-class

Qualifications

See more jobs at Procore Technologies

Apply for this job

+30d

Full Stack Engineer

agileremote-firstvuec++csspythonjavascriptbackend

Northspyre is hiring a Remote Full Stack Engineer

At Northspyre, you’ll join the incredible journey of transforming the way modern real estate teams manage complex projects. Leveraging data, automation and artificial intelligence, Northspyre helps facilitate faster, more predictable outcomes on complex real estate projects. In 5 years, our platform has already facilitated more than $125 billion of complex projects across the United States.

We are a passionate, collaborative, and diverse team who are eager to roll-up our sleeves  and make an impact at a startup that has the confidence and backing of some of the same investors who backed other revolutionary, industry transforming companies like SpaceX, Tesla, and Airbnb.

Help us build software that builds the world!

About the Role:

We are on the lookout for a Full Stack Engineer II to contribute to our rapid growth in this venture-backed startup. This position provides a unique opportunity to play a significant role in disrupting the $10.5 trillion real estate sector. As a lean organization, we pride ourselves on efficiency and effectiveness, making this an opportunity for those who thrive in a fast-paced, dynamic environment.

Responsibilities:

  • Designing and building elegant and user-friendly UIs.
  • Designing and developing backend systems and APIs.
  • Refactoring legacy code and systems to increase maintainability and efficiency.
  • Writing Unit Tests and developing testing frameworks.
  • Collaborating with Customer Support and Product to handle client requests and issues.
  • Maintaining, monitoring and troubleshooting production systems to make sure everything runs smoothly.
  • Ensure information security across our systems.
  • Adhering to agile development practices and improving in our processes.
  • Communicating with team members clearly and effectively.
  • Staying abreast of developments in web applications and programming languages.

 

Qualifications:

  • BS degree in Computer Science or equivalent practical experience.
  • 3+ years of discreet full-stack engineering experience.
  • Strong understanding of data structures, algorithms, and computational complexity.
  • Proficiency in one or more general-purpose programming languages such as Python or JavaScript.
  • Solid front-end development skills (HTML, CSS, JavaScript) with knowledge of React, Vue, Webpack, and NPM.
  • Experience scaling systems in production, particularly with cloud-based technologies like AWS.
  • Familiarity with Unix/Linux environments, large software systems, and/or security software development.
  • Willingness and ability to learn additional coding languages as required.
  • Fluent in verbal and written English.

Bonus Points for:

  • Knowledge of programming frameworks like Flask and/or Django.
  • Experience and knowledge working with AWS.

A reasonable estimate of the total compensation range for this role’s listed level is currently $110k - $160k but may vary based on local market data by region. Role levels and salary ranges take into account a number of factors including, but not limited to, interview performance, skills, experience, knowledge, training and education, certifications and licenses, market data and other business needs.

This role is also eligible for equity and benefits.

Benefits and Perks (Full-Time Employees)

  • In addition to a competitive salary, we are offering a meaningful stock option package
  • Comprehensive Medical, Dental, and Vision. Multiple plan options, including a plan option for 100% employer-paid premium for individual coverage for full-time employees.
  • 401k Match to help you save for your future (Fully vested after 6 mo eligibility period)
  • Unlimited Vacation, Paid Sick Leave, and major US Holidays
  • $45 monthly stipend towards ClassPass (fitness/spa)
  • Awesome company swag!
  • Free access to Health Advocate
  • Remote-first work environment -we have an office in NYC, but our teammates are all over the United States and around the world
  • You will be part of a small, professional fast-moving team with minimal supervision
  • Annual team gatherings

Top Three Reasons to Join

#1: It’s the Right Time –We’ve already facilitated more than $125 billion of complex projects across the United States

#2. Northspyre has the right product –Our technology empowers modern real estate teams to build leveraging data, automation and artificial intelligence to get to faster, more predictable outcomes on complex projects.

#3. Northspyre celebrates a culture of creativity –We strive to have a sense of community within Northspyre that encourages diverse viewpoints, openness, and fostering an environment in which employees feel comfortable bringing their whole authentic selves to work.

We know the confidence gap and imposter syndrome can get in the way of meeting spectacular candidates, so please don’t hesitate to apply — we’d love to hear from you.

See more jobs at Northspyre

Apply for this job

+30d

Full Stack Software Engineer - Poland

Designapigitc++mysqllinuxPHP

Feedonomics is hiring a Remote Full Stack Software Engineer - Poland

Full Stack Software Engineer - Poland - Feedonomics - Career PageSee more jobs at Feedonomics

Apply for this job

+30d

Fullstack Engineer

Lumos IdentityRemote
figmaDesignslackgraphqltypescriptpythonbackendfrontend

Lumos Identity is hiring a Remote Fullstack Engineer

In 2011, Mark Andreessen famously said, “Software is eating the world.” 10+ years later, software hasn’t just nibbled, it has indulged in a lavish ten-course feast at a Michelin star restaurant. From Slack to Zoom to Figma, software is embedded in every company’s DNA. And while most just get to enjoy the benefits, there is one unsung hero behind it all: ????‍♀️ IT ????‍♀️

While being flooded with never ending IT tickets, they are also making sure Guy Fieri in Sales doesn’t buy yet another tool “promising” a 103% lead conversion rate. And burying themselves in spreadsheets to prepare the SOC2 report for when Gordon Ramsey from the Big 4 comes knocking. And can’t forget about Julia Child, the newest on-call engineer, who needs access to prod DB to investigate an incident. All of these workstreams are among spreadsheets, emails, Slack messages, and Zoom calls. But those days are numbered.

✨ Let there be Lumos

Lumos is building the first AppHQ for companies. In essence, we are creating the meta app, the source-of-truth for companies to manage all their apps.

Why Lumos?

  • ???? Rocketship Growth: In less than two years, our team has grown from 20 to ~80 brilliant minds across Canada, the United States and South America. Our customer base has more than 10x’d with some pretty incredible names like SiriusXM, GitHub, and Intercom.
  • ???? Backed by Industry Leaders: Andreessen Horowitz (a16z) has backed us since the beginning. We have a team of trusted advisors including Joel De La Garza (partner at a16z and previous Chief Security Officer at Box) and Leland Maschmeyer (the design thinker behind Spotify and Microsoft)
  • ⭐ Grow with us: You have the chance to be one of the first 100 people at Lumos. At Lumos, you will build your function from the ground up, get exposure to different aspects of the business developing a diverse skill set, and most importantly, you’ll have the opportunity to pave your own path.

We are rewriting the IT playbook, one that better reflects our software eaten world. 

We’re seeing very strong adoption with core products, and in order to double down our investment and support accelerating growth, we’re hiring a Fullstack Engineer to join the team. You'd be among the first 100 employees and set the foundation for extreme growth. ????

You'll build and own core product features, in addition to helping to ensure the health of our engineering systems. You will work across the stack, focusing on areas you are most excited about and that bring value to customers. Beyond your technical work, you will gain leadership opportunities early on as we grow our engineering team. You'll be involved in scaling the product, the team, and the entire company. ????

✨ Your Responsibilities

  • Solve challenging technical problems across the stack to develop critical customer-facing features; includes the frontend (React, Typescript), communication layer (GraphQL, Apollo), and backend (Python, Flask, sqlalchemy).
  • Drive end-to-end development of projects and see the feature through to launch and own iterations and followups.
  • Design and build robust, scalable systems that enable us to scale our platform to 10x the number of users.
  • Uplevel your team by providing feedback and potentially mentoring junior engineers or interns.
  • Become an expert in the Lumos product, working with other stakeholders to refine user requirements and team goals.
  • Grow the engineering team! Interview candidates and refine our recruiting processes as we rapidly grow.

????Pay Range

$125,000 - $150,000. Note that this range is a good faith estimate of likely pay for this role; upon hire, the pay may differ due to skill and/or level of experience.

???? What We Value

We care much more about your motivation and excitement to grow into the role than we care just about your CV. Instead of focusing on what people need to have, we focus on what people need to do. Additionally, we try to find out whether you would be a good fit for Lumos based on our values that define how we achieve outcomes and what characteristics we value.

We strongly encourage individuals from underrepresented groups to apply. ????

???? Benefits and Perks:

  • ???? Remote work culture (+/-4 hours Pacific Time)
  • ⛑ Medical, Vision, & Dental coverage covered by Lumos
  • ???? Company and team bonding trips throughout the year fully covered by Lumos
  • ???? Optimal WFH setup to set you up for success
  • ???? Unlimited PTO, with minimum time off to make sure you are rested and able to be at your best
  • ???????? Up to (4) months off for both the Birthing & Non-birthing parent
  • ???? Wellness stipend to keep you awesome and healthy
  • ???? 401k contribution plan

Apply for this job

+30d

Sr. Fullstack Software Engineer - Subscriptions

remote-firstterraformDesignhtml5dockerelasticsearchtypescriptcsskubernetespythonAWSjavascriptbackendfrontend

ReCharge Payments is hiring a Remote Sr. Fullstack Software Engineer - Subscriptions

Who we are

In a world where acquisition costs are skyrocketing, funding is scarce, and ecommerce merchants are forced to do more with less, the most innovative DTC brands understand that subscription strategy is business strategy.

Recharge is simplifying retention and growth for innovative ecommerce brands. As the #1 subscription platform, Recharge is dedicated to empowering brands to easily set up and manage subscriptions, create dynamic experiences at every customer touchpoint, and continuously evaluate business performance. Powering everything from no-code customer portals, personalized offers, and customizable bundles, Recharge helps merchants seamlessly manage, grow, and delight their subscribers while reducing operating costs and churn. Today, Recharge powers more than 20,000 merchants serving 90 million subscribers, including brands such as Blueland, Hello Bello, CrunchLabs, Verve Coffee Roasters, and Bobbie—Recharge doesn’t just help you sell products, we help build buyer routines that last.

Recharge is recognized on the Technology Fast 500, awarded by Deloitte, (3rd consecutive year) and is Great Place to Work Certified.

Who We Are

Recharge is the leader in powering the best commerce companies on the internet in subscriptions, memberships, workflows, and optimization products. Recharge powers over 50M subscriptions worldwide and has processed more than 10B in transactions. More than 15K brands such as Verve Coffee Roasters, Bokksu, Who Gives A Crap, and Bite Toothpaste Bits rely on Recharge daily to grow their businesses and delight their customers.


Role Overview

The Subscriptions Team at Recharge is responsible for several services core to our business as well as building pivotal core features at Recharge for our merchants, and their customers. They work to build, maintain, and improve several services including Subscriptions, Orders, Discounts, Shipping, Taxes, and a key integration with Shopify.

We're looking for engineers who like to collaborate closely with others and relentlessly seek ways to improve our code base, processes, and themselves.

Our Tech Stack:Python, Flask, VueJs, Kubernetes, GCP, Elasticsearch, Redis, Terraform, OpenTelemetry, Docker, Splunk, SignalFx,CloudSQL/MySQL

Who you are

We recognize that there are a variety of personalities and work styles. Here are some facets of people who enjoy working at Recharge engineering:

  • You love remote work, but not working alone. You love not commuting to work, but you also love collaborating to clarify, confirm, theorize, figure out, and decide on solutions to problems
  • You love exploring ideas with rapid prototyping and prioritizing the ones that have an immediate business impact
  • You love tackling challenges on different fronts like code, infrastructure, documentation, and evangelizing new libraries and services to stakeholders
  • You love the fast-paced nature of the eCommerce world
  • You are good at breaking up work into near, mid, and long-term phases so you can deliver value all along the way as you work toward a clear overall direction.
  • You love rapid iterative design and development while gaining context and understanding along the way. You can recognize when you know enough to take the next useful step to deliver value

What you’ll do

  • Build high-impact, high-performance, high-scale products for development teams to succeed in the delivery of features
  • Understand roadmap priorities and write frontend and/or backend code focused on scalability, testability, supportability, and maintainability
  • With your technical expertise you will manage project priorities, deadlines, and deliverables
  • Debug production issues across stack. 
  • Perform thorough code reviews and provide useful constructive feedback.
  • Contribute to cultivating a positive team environment
  • Demonstrate a willingness to lean in as needed when duty calls

What you’ll bring

  • A knack for engineering simple solutions to solve complex problems
  • Self-driven; pragmatic; a passion for taking ownership of your work and delivering outcomes
  • Ability to work remote-first in a high-growth company
  • Ability to demonstrate high self-sufficiency to take on and complete projects promptly
  • We need our engineers to be versatile, display ownership qualities and be enthusiastic to take on new problems across the full-stack as we continue to push technology forward
  • Experience with Python, Serverless, Kubernetes, and Cloud Platforms such as GCP or AWS, HTML5, CSS3, and JavaScript
  • Demonstrable expertise with HTML5, CSS3, and JavaScript

Experience / Education / Qualifications

  • Typically, 5+ years of relevant full stack development experience across back-end such as Python, Nodejs, and front-end experience including JavaScript and/or TypeScript, HTML, CSS or equivalent.
  • Familiarity with micro-service architecture
  • Bachelor’s degree in Computer Science, or other STEM-related field or equivalent work experience
  • Demonstrable cloud computing experience
  • Prior e-commerce experience preferred

All that said, we know people have varied backgrounds. If you don't meet 100% of the requirements, but you know you can do the job, we believe in you! We'd love for you to apply anyway, and tell us why you'd be a great addition to the team.



Recharge | Instagram | Twitter | Facebook

Recharge Payments is an equal opportunity employer. In addition to EEO being the law, it is a policy that is fully consistent with our principles. All qualified applicants will receive consideration for employment without regard to status as a protected veteran or a qualified individual with a disability, or other protected status such as race, religion, color, national origin, sex, sexual orientation, gender identity, genetic information, pregnancy or age. Recharge Payments prohibits any form of workplace harassment. 

Transparency in Coverage

This link leads to the Anthem Blue Cross machine-readable files that are made available in response to the federal Transparency in Coverage Rule and includes network negotiated rates for all items and services; allowed amounts for OON items, services and prescription drugs; and negotiated rates and historical prices for network prescription drugs (delayed). EIN 80-6245138. This link leads to the Kaiser machine-readable files.

#LI-Remote

See more jobs at ReCharge Payments

Apply for this job

Tucows is hiring a Remote Full Stack Engineer

Job Application for Full Stack Engineer at Tucows

See more jobs at Tucows

Apply for this job