terraform Remote Jobs

399 Results

+30d

Senior Site Reliability Engineer - (GS)

ITScoutLATAM, AR Remote
terraformDesignmobilerubyjavaelasticsearchpython

ITScout is hiring a Remote Senior Site Reliability Engineer - (GS)

⚠️Only available for #residents of #Latinamerica⚠️


Our client builds smart technology solutions through the combination of artificial intelligence, mobile, and web development for companies in the United States, Canada & Latam. It´s a technology company headquartered in Costa Rica. With operations throughout LATAM. Their core focus is building intelligent tech solutions to help our customers be more efficient in optimizing internal digital processes.

About the job Senior Site Reliability Engineer

Join our team as a Senior Site Reliability Engineer and become an integral part of our core & observability team, responsible for ensuring the operational efficiency of our cloud platforms and services.

Responsibilities:

  • Hands-on production of software for our products.
  • Establishing design patterns and frameworks for service reliability.
  • Collaborating with teams to instrument system, application, and business KPIs.
  • Defining processes for hosting and deploying live services.
  • Conducting code reviews and driving continuous improvement processes.

Qualifications:

  • Solid understanding of networking systems and protocols.
  • Experience with managing large-scale web operations in a public cloud environment.
  • Proficiency in programming languages such as Ruby, Go, Java, Python, or equivalent.
  • Familiarity with monitoring and observability tools like Prometheus, Grafana, Elasticsearch, Logstash, Kibana.
  • Experience with infrastructure-as-code technologies (e.g., cloudformation, terraform).

**English: B2+ proficiency required.

See more jobs at ITScout

Apply for this job

+30d

Senior Devops Engineer (GCP)

EurofinsBarcelona, Spain, Remote
7 years of experienceagileBachelor's degree3 years of experienceterraformDesignansibleazurekubernetesubuntulinuxAWS

Eurofins is hiring a Remote Senior Devops Engineer (GCP)

Job Description

In a nutshell

As a Senior Devops Engineer, you will join a challenging and unique large-scale Transformation Program with high impact and visibility. Your primary focus will be  the engineering, configuration, installation, and maintenance of public and private cloud, Linux OS and CI/CD; in addition to code maintenance. 

Where will you be based and what business will you support?

Based in Barcelona; you will support project engineering functions within EMEA Infrastructure for the Agroscience, Pharma, Genomic Services and Technologies Business Units

How can you help us? 

You will:

Deliver insights and guidance as we design, build, and operate a state-of-the-art multi-cloud “greenfield” infrastructure by bringing ideas and solutions through an informed viewpoint, as you collaborate with a cross-functional team to develop real-world IT service.

Your primary focus will be:

  • To build, configure and operate Google Cloud Platform (GCP) plus Google Cloud VMware Engine (GCVE), Containers and Kubernetes Clusters (GKE) as code.
  • To Design, build and maintain CICD pipelines, GitFlow, orchestration, etc.
  • To research, evaluate and recommend resources for the CI/CD platform and GCP.
  • To develop, debug, improve and/or code refactoring to deliver infrastructure (Terraform) and configuration (Ansible) lifecycle, automation and innovation initiatives, ability to drive automation initiatives independent of automation tools.
  • Image management as code using Packer.
  • To develop and implement agile and scalable infrastructure solutions, with advanced monitoring and alerting, while establishing best practice tools, frameworks, and processes
  • To perform daily system checks, verifying the integrity and availability of development, testing, staging, and production environments.
  • To identify, diagnose, and resolve connection, reliability, or performance issues.
  • To contact vendor technical support for Priority 1 incidents and requests.

 

Your additional focus areas will be:

  • Specific Azure DevOps experience is a plus.
  • Team members are expected to grow their expertise in other systems engineer areas to provide support for the entire IT infrastructure landscape through formal training, job shadowing, service transition and documentation.
  • Evaluate, recommend, manage, and operate compute and storage resources on Cloud and CI/CD platforms.

 

Core IT Infrastructure Technology / Engineering Duties:

  • Partner with other infrastructure Team Members to learn, develop and enhance the skills needed to support software-based infrastructure.
  • Ensure that IT Services are delivered effectively to business customers. This includes the execution of SOPs (Standard Operating Procedures), management of IT Incidents/Problems and IT Changes as per well-defined ITIL processes, as implemented in the ITSM system (ServiceNow)
  • Contribute to the reference documents to establish consistency and shared knowledge of Operations best practices and delivery methods.
  • Deliver quality documentation allowing smooth day-to-day operations.
  • Perform system monitoring, verifying the integrity and availability of infrastructure resources; Ensure that performance, scalability, and security is maintained and optimized.
  • Identify opportunities to innovate, extend and enhance service delivery wherever possible.
  • Participate in disaster recovery plans and practicing recovery operations.
  • Consult with senior peers to learn through experience.
  • Partner with key vendors to maintain an understanding of modern technology and leading practices.
  • Cooperate closely with other Zone / Regional / Group IT Infra resources.
  • Provide after-hours on-call support (rotation) and participate with solution implementation (upgrades, new releases, …), patching and deployment activities after hours as needed.

Qualifications

Are you our kind of extraordinary?

You have:

  • A Bachelor's degree in computer science / comparable fields or equivalent working experience
  • Minimum 3-7 years of experience working with: Google Cloud Platform environments, building and managing CI/CD pipelines (AzDO), developing Terraform code, and Linux Servers (RHEL and/or Ubuntu).
  • Minimum 1-3 years of experience working with: Ansible, Packer, managing containers and Kubernetes Clusters.

 

What else should I know? 

 

Certifications in any of the following or similar technologies are a plus:

  • Google Cloud, Azure, AWS, Hashicorp Terraform, and Linux (RHEL and/or Ubuntu).
  • ITIL Foundation      

See more jobs at Eurofins

Apply for this job

+30d

Site Reliability Engineer - 1009WFH - 1525

Global InfoTek, Inc.San Antonio, TX Remote
terraformDesignansiblegitkubernetes

Global InfoTek, Inc. is hiring a Remote Site Reliability Engineer - 1009WFH - 1525

Clearance Level: Secret

US Citizenship: Required

Job Classification: Full-time

Location: Remote

Experience: 3-5 years

Education: Bachelor of Science Degree


Position Description:

Global InfoTek, Inc. is looking for a Site Reliability Engineer to join our team to support our customers and join our passionate team of high-impact problem solvers. This opportunity will help build and shape the Air Force organization where customers are their top priority.

Brief Description:

The Site Reliability Engineer works with the DevSecOps Platform Product Line Manager and Infrastructure as Code SME, as well as other team members to ensure that the overall platform design and implementation is able to meet or exceed the service level objectives and agreements relating to uptime, availability, and mean-time-to-recover.

Required Skills:

• SRE principles, practices, tools, and automation

• Service Level Objectives (SLOs) & Error Budgets

• Monitoring and Service Level Indicators (SLIs)

• Anti-fragility, performance management, and incident management

• Experience with automated testing

• Experience in Technical Customer Service, Customer Management, and experience in escalations may be required.

• Functions as a technical expert across the team and tasks.

• Demonstrated experience to run infrastructure with Chef, Ansible, Terraform, GitLab CI/CD, and Kubernetes.

• Demonstrated experience in GitLab products. Improve operational processes (such as deployments and upgrades).

• Demonstrated experience to Design, build and maintain core infrastructure that enables GitLab scaling to support hundreds of thousands of concurrent users.

• Ability to build monitoring that alerts on symptoms rather than on outages.


Desirable Skills:

• Experienced Agile/Scrum

• DoD DevSecOps Reference Design

• DoD Cloud Environments

• GitOps

• Git

• Kubernetes

• Terraform, Helm, Ansible, Flux, and Cosign

• Cloud Computing

• CI/CD Pipelines

• Monitoring tools

• Microservice Architectures

• Istio, Kyverno, and Gatekeeper

Global InfoTek, Inc. is an equal-opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, protected veteran status, or based on disability.

About Global InfoTek, Inc. Global InfoTek Inc. has an award-winning track record of designing, developing, and deploying best-of-breed technologies that address the nation's pressing cyber and advanced technology needs. For close to three decades, GITI has rapidly combined pioneering technologies, operational effectiveness, and best business practices.

See more jobs at Global InfoTek, Inc.

Apply for this job

+30d

DevSecOps Engineer - Senior 1009WFH - 1524

Global InfoTek, Inc.San Antonio, TX Remote
agileBachelor's degreeterraformDesignansibleazuregitdockerkuberneteslinuxjenkinspythonAWS

Global InfoTek, Inc. is hiring a Remote DevSecOps Engineer - Senior 1009WFH - 1524

Clearance Level: Must be eligible for a Secret
US Citizenship: Required
Job Classification: Full Time
Location:Remote

Years of Experience: 3-5 years DevSecOps experience

Education Level: Bachelor's Degree

Brief Description of the Work:

Global InfoTek, Inc. is looking for a DevSecOps Engineer to join our team to support our customers and join our passionate team of high-impact problem solvers. This opportunity will help build and shape the Air Force organization where customers are their top priority.

The DevSecOps engineer will work with all team members to design, develop, build, and update fully automated and self-service capabilities for developers to deploy and manage their approved applications to the DevSecOps Platforms.

Required Skills:

  • A deep understanding for agile and DevSecOps methodologies, with experience in the automation of build tools for modern programming languages
  • Creating and maintaining documentation for implementations.
  • Experience in developing, testing, and maintaining containerized applications.
  • Working knowledge of source version control, build/release tools and methodologies, and CI/CD pipelines, especially using Git, GitLab, and GitOps
  • Capable of building and maintaining CI/CD pipelines for a large enterprise that consists of hundreds of applications.
  • Experience with cloud systems and architectures (Amazon AWS, Microsoft Azure, or Google Cloud Platform (GCP)).
  • Familiarity with Linux and scripting (Bash and Python, etc.).
  • Extensive experience developing Infrastructure as Code (IaC) and Configuration as Code (CaC) using tools like Terraform, Helm, Ansible, Flux, and Cosign
  • Development experience with Kubernetes, Docker, and Helm.

Experience configuring and using CI/CD automated pipelines, such as Jenkins

Desired Skills:

  • Strong oral and written communication skills.
  • General knowledge and experience with Istio, Kyverno, Gatekeeper, ArgoCD, SonarQube, Fortify, and Twistlock, Trivy, or NeuVector
  • Package managers: Maven/Gradle/PyPi/npm
  • Cybersecurity vulnerability scanning (SAST and DAST)
  • NIST Risk Management Framework (RMF)
  • Familiar with microservice architectures (REST, JMS, AMQP).
  • Ability to work on high-performing teams supporting multiple projects and personnel.

Global InfoTek, Inc. is an equal-opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, protected veteran status, or based on disability.

About Global InfoTek, Inc. Global InfoTek Inc. has an award-winning track record of designing, developing, and deploying best-of-breed technologies that address the nation's pressing cyber and advanced technology needs. For close to three decades, GITI has rapidly combined pioneering technologies, operational effectiveness, and best business practices.

See more jobs at Global InfoTek, Inc.

Apply for this job

+30d

Kubernetes - SME 1009WFH - 1523

Global InfoTek, Inc.San Antonio, TX Remote
Bachelor's degreeterraformDesignansibleazuredockerelasticsearchkuberneteslinuxAWS

Global InfoTek, Inc. is hiring a Remote Kubernetes - SME 1009WFH - 1523

Clearance Level: Must be eligible for a secret clearance

US Citizenship: Required
Job Classification: Full Time
Location: Remote

Years of Experience: 3-5 years
Education Level: Bachelor's Degree

Position Description:The K8s Senior will work with the Infrastructure as Code and Site Reliability Engineer SMEs to design, build, and update platform capabilities using Kubernetes native services adhering to Cloud Native Computing Foundation (CNCF) principles, industry best practices, along with the DoD CIO DevSecOps Reference Design, and a loosely coupled microservices-based architecture.

Required Skills:

  • 3 years experience with packaging and securing applications as containers working in Kubernetes
  • IASAE Level II certification (CASP+ CE, CISSP, CISSP Associate, or CSSLP)
  • Demonstrated mastery of Kubernetes, Istio, GitOps, Custom Kubernetes Operators, Custom Helm charts, Kustomize, Custom Admission Controllers, Custom CRDs, and Custom Controllers.
  • Demonstrated mastery of Linux and networking.
  • Demonstrated mastery of Kubernetes and containers.
  • Demonstrated mastery of Kubernetes control plane and each component.
  • Demonstrated mastery of Istio.
  • Demonstrated mastery of security and compliance for Kubernetes.
  • Demonstrated mastery of building automation and configuration management tools (e.g. Ansible, Terraform).
  • Demonstrated mastery of cloud and hybrid cloud architecture Amazon AWS, , Microsoft Azure, or Google Cloud Platform (GCP).
  • Demonstrated mastery of common infrastructure tools like Docker, Terraform, and Helm, Git/GitLab/GitOPs, ArgoCD, Flux, Ansible.
  • Demonstrated mastery working with large-scale products with thousands of end-users.
  • Have a software development background.
  • Demonstrated mastery of creating and maintaining documentation for implementations.
  • CKA OR CKAD Certification.

Desired Skills:

  • Experience managing different Kubernetes providers (e.g., RKE2, Amazon EKS and Fargate, Azure KS and Google KE) or run your own.
  • Experience working at scale with other Architects on Security, Data protection, and Failover-Failback strategies.
  • Experience implementing Continuous Integration, Delivery, and Deployment using different CI/CD tools.
  • Experience with Big Bang (Istio, Elasticsearch, Logstash, Kibana, Prometheus, Kyverno, etc.)
  • NIST Risk Management Framework (RMF)

Global InfoTek, Inc. is an equal-opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, protected veteran status, or based on disability.

About Global InfoTek, Inc. Global InfoTek Inc. has an award-winning track record of designing, developing, and deploying best-of-breed technologies that address the nation's pressing cyber and advanced technology needs. For close to three decades, GITI has rapidly combined pioneering technologies, operational effectiveness, and best business practices.


See more jobs at Global InfoTek, Inc.

Apply for this job

+30d

Frontend Software Engineer - Trust & Safety

CloudflareHybrid or Remote
3 years of experienceterraformDesignuiapiUXc++typescriptcssreduxbackendfrontend

Cloudflare is hiring a Remote Frontend Software Engineer - Trust & Safety

About Us

At Cloudflare, we are on a mission to help build a better Internet. Today the company runs one of the world’s largest networks that powers millions of websites and other Internet properties for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Locations: This role will be based out of our Austin office. Remote candidates in the US will also be considered.

About the department

Cloudflare’s mission is to help build a better internet and the Trust & Safety Engineering (TSENG) team lives at the core of that effort. The team empowers customers with products and services to combat abuse, enables deeper coordination with our external industry anti-abuse partners, and ensures that teams in the company can respond to the quickly changing legal landscape of the internet with scalable tools and services. This includes services that have a direct impact on efforts to stop the spread of CSAM (child sexual abuse material) across the internet. Read more about our CSAM Scanning tool here.

About the Role

Engineers on the Trust & Safety Engineering team are responsible for the entire software development lifecycle for our products and services which include both internal and customer-facing software. Whether closing gaps in our abuse processing pipeline, extending our Trust & Safety platform or road mapping the future of Trust & Safety solutions, software engineers on the Trust & Safety Engineering team are critical to Cloudflare’s ability to help make the internet a better place. 

What you'll do

As someone who will work closely with product owners, UX designers and T&S team members directly, you should be skilled in communicating with non-technical stakeholders. You will also collaborate with the backend engineers on the team on design and functionality of APIs that power our UIs. We work iteratively and deploy often (can be several times a day). We build and maintain several internal and external facing UIs which are TypeScript / React applications. 

Responsibilities include

  • Designing, building, maintaining and scaling UIs to extend functionality of the internal Trust and Safety dashboard
  • Analyzing and communicating complex technical requirements and concepts, able to identify the highest priority areas and carve a path to deliver
  • Collaborating with product and design teams to understand goals and translate UI design into products that align with the customer need
  • Collaborating with other software engineers in the team to align on API designs and functionality
  • Working closely with Cloudflare's Trust and Safety team to help make the internet a safer place
  • Facilitate technical collaboration on frontend between Trust and Safety Engineering Team and other frontend teams in Cloudflare

Examples of desirable skills, knowledge and experience

  • More than 3 years of experience designing, building and maintaining production web applications
  • Strong knowledge of TypeScript, React, HTML and CSS
  • Experience with Cloudflare developer platform and tooling, specifically Pages and Workers ecosystem
  • Experience building high quality automated tests and leading user acceptance testing exercises
  • Track record of demonstrating empathy for the user in delivery of high quality UIs
  • Ability to work in cross-functional teams in a fast paced environment

Bonus

(Relevant but not required - we love to learn on the job!)

  • Prior experience working in the Trust & Safety domain space or building internal review tooling
  • Understanding of DNS, TLS/SSL and HTTP
  • Expertise in web security issues and industry standards for access control
  • Familiarity with other technologies such as Redux, Jest, Enzyme, Cypress and Terraform



 

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

+30d

Ingénieur Réseau VSAT (H/F)

CITECHMarseille, France, Remote
terraformansiblec++jenkins

CITECH is hiring a Remote Ingénieur Réseau VSAT (H/F)

Description du poste

???????? Vous aurez donc les missions principales suivantes : ????????

???? Réaliser l'étude et l'architecture des infrastructures : VSAT, LAN, WiFi pour nos nouvelles constructions de porte-conteneurs.
???? Travailler à l'automatisation des processus de collecte, de normalisation et d'analyse des données de télémétrie des journaux de réseau.
???? Documenter et partager les connaissances et les meilleures pratiques au sein de l'équipe.
???? Communiquer efficacement avec le groupe et les équipes concernées par ces projets.

Qualifications

⚙️ Les compétences attendues sont les suivantes :

✔️ Vous connaissez l’environnement technique suivant :
LAN : Cisco
WLAN : Cisco Meraki
DDI/DNS : EfficientIP
Monitoring, Alerting et Log Management : Icinga, ELK
Automation & Orchestration : Ansible, TerraForm, GitLab, Jenkins
Vsat : C-band, Ku-band, Ka-band
✔️ Vous avez un très bon niveau d’anglais.

☑️Tous nos postes sont ouverts aux personnes possédant le statut RQTH.

See more jobs at CITECH

Apply for this job

+30d

Senior Cloud Platform Engineer

SignifydDenver, CO; New York City, NY; United States (Remote);
Bachelor degreeterraformDesignjavaelasticsearchmysqltypescriptkubernetespythonAWSjavascript

Signifyd is hiring a Remote Senior Cloud Platform Engineer

Signifyd is looking to hire a Senior Cloud Platform Engineer responsible for the design, implementation, and management of our cloud-based infrastructure. You will lead a team of highly skilled engineers maintaining and automating a vast cloud-based computing environment supporting Signifyd’s decision platform. The candidate will collaborate with development teams and fellow cloud infrastructure engineers to address critical issues. Proficiency in cloud technologies, containers, Kubernetes, networking, security, scripting, automation, and platform engineering, ensuring seamless system operations. The candidate should possess strong technical aptitude, software development skills, analytical and communication skills, and exceptional problem-solving ability. For this role, we are open to hiring an SE3 or SE4 level.

What You'll Do

  • Collaborate with cross-functional teams to design, build, and maintain highly available, scalable, and secure cloud-based services, promoting efficiency and self-service principles.
  • Develop and maintain automation scripts and tools to streamline infrastructure provisioning, configuration, and deployment, empowering engineering teams.
  • Implement and manage Kubernetes clusters for container orchestration, monitoring, and scaling.
  • Drive an evolution of services to support cloud-native managed services, including an evolution of Kubernetes.
  • Drive efforts to enhance cloud infrastructure security, including access controls, encryption, and vulnerability assessments, focusing on engineering security solutions.
  • Collaborate on CI/CD (TeamCity) pipelines to automate software deployment, including the build platform (Java, Gradle Enterprise) and QA/Testing tooling to drive DevEx up and CFR to zero, emphasizing engineering and self-service automation.
  • Define and maintain cloud engineering best practices and standards to ensure design and implementation consistency.
  • Collaborate with software engineers to optimize applications for cloud deployment, emphasizing performance and scalability.
  • Evaluate emerging cloud and DevOps technologies, providing recommendations for integration into cloud engineering practices.
  • Participate in capacity planning and resource optimization for cost-effective cloud infrastructure usage.
  • Troubleshoot complex engineering issues, provide root cause analysis and propose engineering-focused solutions.
  • Create and maintain comprehensive documentation related to the cloud infrastructure, engineering practices, and security configurations.
  • Mentor and provide technical guidance to junior team members, fostering a culture of excellence.

 

What You'll Need

  • Proficiency in cloud platforms (AWS, GCP) with a focus on engineering best practices.
  • Extensive expertise in Kubernetes (self-managed and cloud-managed flavors, architectures, operations, etc.), cloud infrastructure (AWS and GCP), and ideally databases (at least one of MySQL, Cassandra, DynamoDB, or Elasticsearch)
  • Deep knowledge of best practices for cloud environments, including security, cost optimization, operational excellence, reliability, and performance efficiency.
  • In-depth knowledge of networking principles, protocols, and security best practices for high-performance solutions.
  • Strong understanding of DevOps practices, CI/CD pipelines (TeamCity, GitHub Actions, AWS CodePipeline), and infrastructure-as-code tools (e.g., Terraform, Pulumi).
  • Excellent problem-solving skills, effective in a fast-paced, collaborative environment.
  • Excellent experience in Infrastructure-As-Code (IaC) best practices (Terraform).
  • Experience in software development in general, with skills in a high-level language (e.g., Python, JavaScript, TypeScript, Java) and familiarity with modern development practices
  • Understanding of Cloud Observability, Monitoring, and Tracing tools (Datadog, CloudWatch, Jaeger, ELK) and how best to leverage to support effective MTTR and mitigate high CFR

#LI-Remote
 

Benefits in our US offices:

  • Discretionary Time Off Policy (Unlimited!)
  • 401K Match
  • Stock Options
  • Annual Performance Bonus or Commissions
  • Paid Parental Leave (12 weeks)
  • On-Demand Therapy for all employees & their dependents
  • Dedicated learning budget through Learnerbly
  • Health Insurance
  • Dental Insurance
  • Vision Insurance
  • Flexible Spending Account (FSA)
  • Short Term and Long Term Disability Insurance
  • Life Insurance
  • Company Social Events
  • Signifyd Swag

We also want to provide an inclusive interview experience for all, including people with disabilities. We are happy to provide reasonable accommodations to candidates in need of individualized support during the hiring process.

Signifyd provides a base salary, bonus, equity and benefits to all its employees. Our posted job may span more than one career level, and offered level and salary will be determined by the applicant’s specific experience, knowledge, skills, and abilities, as well as internal equity and alignment with market data.

USA Base Salary Pay Range
$160,000$200,000 USD

See more jobs at Signifyd

Apply for this job

+30d

Quant Developer onsite or remote (in Germany or Austria)

Scalable GmbHWien, Austria, Remote
agileterraformsqlDesigndockerpythonAWSbackend

Scalable GmbH is hiring a Remote Quant Developer onsite or remote (in Germany or Austria)

Job Description

In this role you will be responsible for developing and fully automating the trading algorithms, encompassing risk, cost, and tax optimization in cost-effective burst computations with the capacity to handle 1mn trades in 10 minutes for less than €10. In the near to medium term, you will also focus on upgrading our technology for capital taxation and addressing regulatory demands associated with market risk.

Furthermore, you will productionize algorithmic models that autonomously react to client requests and market movements across multiple tax regimes. This involves customizing smart rebalancing, cash-flow management strategies, inventory adjustments, all of this carried out on a cutting edge stack with the capacity to handle hundreds of thousands of individual trading decisions in minutes.

The Quant Development team leverages its knowledge to bring unique insights to clients that are otherwise reserved for institutional investors. For example, the Smart Predict feature, developed by the Quant Development team, offers clients an execution probability for limit and stop orders, generated by a sophisticated machine learning model.

  • Develop hands-on in Python alongside a highly motivated team of software engineers and quant developers, driving transformative changes in the financial industry
  • Get to work on cutting edge technology and be part of modern software development practices (e.g. agile and self-sufficient teams, continuous integration and deployment, test automation, cloud-based infrastructure and tooling)
  • Manage the development of high-performance risk management tools serving regulatory purposes, near-real-time interactive dashboards and alerting systems overlooking the risk exposure in tens of thousands of positions
  • Create the next generation wealth management and brokerage services for everybody
  • Architect and deploy interfaces connecting the Scalable Capital Robo with key internal services to establish seamless connectivity with the external world
  • Contribute and develop data-driven ideas aimed at generating business value
  • Drive continuous improvements of data pipelines with respect to requirements and platform dependencies
  • Fully automate trading algorithms driven by pure quantitative evidence that autonomously manage billions in assets
  • Bridge the worlds of engineering and science by productionizing econometric models that react to market movements and client requests in hundreds of thousands of individual portfolios
  • Never implement any of the above in spreadsheet tools
  • Support investment managers, trading, backend, wealth management, risk

Qualifications

  • Excellent university degree in computer science, mathematics, natural sciences, or a similar field
  • Knowledge in econometrics with an emphasis on portfolio optimization and risk modelling
  • Passion for the global financial markets
  • Experience with convex optimization, exposure to libraries like cvxpy, scipy or cvxopt
  • Experience in quantitative modeling and data-driven decisions
  • Exposure and interest in our tech stack: Python, Docker, CI/CD pipelines,  Infrastructure as Code (Terraform), SQL
  • Experience with cloud providers like AWS
  • Knowledge of software development and software design in Python
  • Excellent communication skills that are clear, concise, and targeted towards your audience - engineering, product, or other stakeholders
  • Knowledge of relational databases / SQL
  • Fluent English language skills (written & spoken)
  • Proactive and independent working style, good time management, fair play

We would be happy if you write to us in the "message to the Hiring Manager" section about what excites you about the role and why you think you would be a great fit! Applications without such motivation will not be considered.

See more jobs at Scalable GmbH

Apply for this job

+30d

[MSO] Senior Back-end Engineer (Python + Terraform)

Software MindWarsaw, Poland, Remote
Commercial experienceterraformDesignkubernetespython

Software Mind is hiring a Remote [MSO] Senior Back-end Engineer (Python + Terraform)

Job Description

Project - the aim you'll have

You will be responsible for building private cloud solution for government in one of the countries in Western Europe. In addition to building, the focus is also on migration and maintenance of created solution.

Position - how you'll contribute

  • Design, programming, testing and implementation of new back-end applications.
  • Testing and improving existing back-end applications.
  • Meetings with architects, functional designers, and other specialists regarding the design of a system or application.

Qualifications

Expectations - the experience you need

  • Min. 5 years of commercial experience with Python
  • Min. least 1 years of experience with different Terraform solutions.
  • Experience with Gitlab pipelines
  • In-depth infrastructure and network knowledge (firewalls, reverse proxies, forward proxies, networking (IPV4, IPv6))

Additional skills - the edge you have

  • Experience with Kubernetes and Helm
  • Experience with building highly automated public cloud solutions. 

See more jobs at Software Mind

Apply for this job

+30d

Cloud Hybride Engineer H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
terraformansibleazurec++kuberneteslinuxAWS

Devoteam is hiring a Remote Cloud Hybride Engineer H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que Cloud Hybrid Vmware Engineer

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

L’analyse des besoins clients

  • Participer aux ateliers de cadrage des solutions afin d’étudier les besoins clients

  • Aider à la définition d’architectures de Cloud Privé et de Cloud Hybride sur la base de solutions VMWare

  • Participer à la conception et la mise en œuvre de solutions VMware Cloud Foundation avec vCenter, VSAN et NSX-T

  • Participer à la rédaction des documents d'architecture (HLD, LLD, DEX) et de préconisations

Le déploiement et l’automatisation des architectures VMWare

  • Mettre en place les outils d’automatisation

  • Déployer et industrialiser les architectures cibles

  • Mettre en oeuvre les solutions de monitoring adaptées à l’environnement client

  • Veiller à la sécurité et la fiabilité des environnements déployés

  • Optimiser les performances des différents outils et participer à la résolution d’incidents

  • Analyser et proposer des axes d’amélioration sur les architectures pour optimiser les composants

Participation aux opérations de maintenance

  • Optimiser les performances des infrastructures VMWare et participer à la résolution d’incidents

  • Gérer les utilisateurs, les groupes, les rôles et les autorisations

  • Gérer la maintenance continue, par exemple l'installation de Service Pack, les correctifs, les mises à jour de logiciels, etc.

Où réaliserez-vous vos missions ? Chez des clients grands comptes de la banque, de l’assurance, de l’industrie, du retail de la Défense, du luxe ou encore de l’énergie, porteurs de projets innovants.

Qualifications

Ce que vous apporterez à la Tribu ?

Consultant.e VMWare, issu.e d’école d’ingénieurs ou d’un Master 2 en informatique, vous êtes doté.e d’un excellent relationnel, d’un sens prononcé du service et de la qualité. Vous aimez travailler en équipe, et parlez couramment français et anglais.

Vous avez une première expérience professionnelle sur les technologies et les outils de la virtualisation (KVM, XEN et plus particulièrement VMWare Cloud Foundation, VSphere 6.5,6.7 ou 7, VRealize Automation, vRealize Orchestrator, VSAN, NSX-T, vMotion, DRS, SRM,...). 


Vous connaissez et vous vous voulez progresser sur : 

  • les architectures de stockage (NAS/ SAN/ DAS), 

  • les architectures réseaux et télécoms

  • les outils tiers (Terraform, Ansible, Veeam, SCCM, Citrix, PowerShell, …)

  • et vous avez un socle de connaissances confirmé en environnement Windows Server, Linux et Kubernetes

Vous souhaitez affirmer une trajectoire professionnelle vers des sujets d’automatisation d’infrastructure et de cloud privé ou hybride (AWS, Azure, GCP, OVH). 

Vous souhaitez développer votre sens critique en tant que consultant.e au regard des problématiques Cloud et des adhérences middlewares aux éléments sous-jacents des architectures du système d’information et des applications. 

[Cherry on the cake????]

Votre curiosité au sujet des risques liés à la sécurité des infrastructures virtuelles, des normes applicables (ANSSI, NIST, CIS,…) de cybersécurité serait un plus.
 

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

+30d

SysOps Engineer H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
terraformansibleazurec++kuberneteslinuxjenkinspythonAWS

Devoteam is hiring a Remote SysOps Engineer H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que SysOps Engineer 

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

Déploiement et automatisation des infrastructures

  • Mettre en place les outils d’automatisation et de provisionning des infrastructures (Ansible, Jenkins, Terraform,...) et gérer leur cycle de vie avec des solutions comme GitHub, GitLab et Azure DevOps 

  • Déployer et industrialiser les architectures et les services cibles

  • Mettre en oeuvre les solutions de sauvegardes et de supervision adaptées à l’environnement client

  • Veiller à la sécurité et la fiabilité des environnements déployés

  • Analyser et proposer des axes d’amélioration sur les architectures pour optimiser les composants

Participation aux opérations de maintenance

  • Optimiser les performances des infrastructures et participer à la résolution d’incidents

  • Gérer le cycle de vie des infrastructures et des services déployés

  • Gérer les utilisateurs, les groupes, les rôles et les autorisations

  • Gérer la maintenance continue, par exemple l'automatisation des déploiements des Service Pack, les correctifs, les mises à jour de logiciels, etc.

Où réaliserez-vous vos missions ? Chez des clients grands comptes de la banque, de l’assurance, de l’industrie, du retail de la Défense, du luxe ou encore de l’énergie, porteurs de projets innovants.

???? A terme, vous avez envie d'évoluer vers un poste d’architecte infrastructure et Cloud, de Chef de Projet, de Tech Lead ou d'Expert Cloud ?

Notre stratégie pour accompagner nos consultants est de former nos équipes par des Gourous et de les certifier grâce à nos partenaires privilégiés (VMware, AWS,

Microsoft, Google, Red Hat...) ou encore sur les technologies Cloud et DevOps (Terraform, Kubernetes, Ansible,...)

Pour activer cette trajectoire, My Devoteam Academy vous proposera des actions de formation, de parrainage  et des certifications avec nos partenaires, ainsi qu’un dispositif d’évaluation personnel régulier, notamment :

Aussi, vous trouverez du soutien pour approfondir certains sujets grâce à Devolab (plateforme de labs à disposition des consultants). 

 

Qualifications

Ce que vous apporterez à la Tribu ?

[Les compétences idéales] 

Consultant.e infrastructure et automatisation, issu d’école d’ingénieurs ou en Master 2 en informatique, vous êtes doté.e d’un excellent relationnel, d’un sens prononcé du service et de la qualité. Vous aimez travailler en équipe, et parlez couramment français et anglais.

Vous avez une première expérience professionnelle sur Terraform, Ansible, PowerShell, Python ainsi qu’un socle de connaissances confirmé en environnement Windows Server, Linux et Kubernetes.

Vous souhaitez affirmer une trajectoire professionnelle vers des sujets d’automatisation d’infrastructure et de Cloud Privé ou hybride (AWS, Azure, GCP, OVH).

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

​​​​Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

+30d

Python DevOps Developer H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
agilejiraterraformansibleazureapigitc++dockerkuberneteslinuxjenkinspythonAWS

Devoteam is hiring a Remote Python DevOps Developer H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que Python DevOps Developer 

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

  • Comprendre le besoin utilisateur et y répondre en livrant régulièrement des fonctionnalités ayant de la valeur métier,

  • Assurer le développement d’outils visant à industrialiser/automatiser le déploiement sur les différents environnements du développement à la production (conception & structuration, qualité de code, pair-programming, revue de code…),

  • Accompagner les équipes de dev par la mise en place de pipelines CI/CD, d’Infra As code et de conteneurs pour leurs applications,

  • Accompagner les équipes de production dans la mise en place de bonnes pratiques de delivery de ces outils (gestion de sources, gestion de configuration, automatisation des tests…) ;

  • Apporter la culture du développement agile dans les différentes features teams, faciliter la coopération et l'entraide, partager la connaissance via les outils

  • Intervenir au sein d’écosystèmes techniques DevOps et des plateformes de CI/CD complexes pour des milliers d’utilisateurs 

  • Assurer une veille technologique et s'intéresser aux nouvelles pratiques émergentes

Selon les projets, voici les technologies que vous serez amené.e à rencontrer :

  • Scripting : Python, Bash, Shell

  • Programmation : Python, Django, Flask

  • Architectures orientées services (MicroServices & REST API)

  • CI/CD : Gitlab, GitHub, Jenkins, Nexus, Sonarqube

  • Versionning : Git

  • Containers : Docker, Kubernetes

  • Infrastructure As Code : Terraform, Ansible

  • Collaboration : Jira, Confluence

  • Tests : Selenium

  • Système : Windows, Linux

  • Cloud : AWS, AZURE, GCP

Qualifications

Ce que vous apporterez à la Tribu ?

[Les compétences idéales] 

Diplômé.e d’une École d’Ingénieurs ou d’un Master 2 en IT, vous êtes passionné.e par le langage Python dans des contextes Cloud / DevOps et avez au moins 3 ans d’expérience en scripting ou développement sur Python 3 et ses librairies. Que vous veniez du Dev, des Ops, du DevOps, vous avez acquis de solides compétences en automatisation et amélioration continue.

Vous avez déjà une première expérience dans l’utilisation ou la mise en place d’outils de l’écosystème DevOps - CI/CD et vous souhaitez aller plus loin sur ces sujets.

[Cherries on the cake????]

  • Une expérience des frameworks Flask & Django et des outils d’industrialisation (Git, Jenkins, Ansible, Docker…)

  • Une expérience en utilisation ou implémentation de plateformes CI/CD avec des composants “Enterprise” (GitLab / GitHub)

  • Des connaissances et de la pratique en conteneurisation et sur un Cloud provider 

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

+30d

Architecte Cloud Hybride H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
agileterraformansibleazurec++dockerkuberneteslinuxAWS

Devoteam is hiring a Remote Architecte Cloud Hybride H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que Architecte Cloud Hybride

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

La conception d’architectures multicloud et  Cloud Hybride 

  • Accompagner et effectuer des études de choix de solutions techniques en fonction des besoins de nos clients et au regard du marché IT

  • Concevoir, valider et participer à la mise en œuvre des architectures de Cloud Privé et de Cloud Hybride, basé sur les technologies (VMware, Azure, OVHcloud, AWS, GCP, Red Hat, Kubernetes, …)

  • Etablir les modes de consommation des services et la gestion du cycle de vie de ces derniers

  • Etablir les plans de continuité et de reprise des infrastructures, services et applications

  • Anticiper la gestion financière des infrastructures et des services mis en oeuvre et les impacts sur la gestion contractuelle 

  • Définir et participer à la rédaction des documents d'architecture (HLD, LLD, DEX) et de préconisations

  • Organiser et planifier des comités de validation des architectures, assurer un reporting hebdomadaire

  • Concevoir et valider les services d'infrastructures : outillage d'exploitation, système (serveurs et fermes mutualisées), données (stockage, sauvegarde), middleware, réseaux, sécurité…

Le déploiement des architectures cloud

  • Organiser et participer à la construction des socles techniques (gouvernance, landing zone, architecture de références, sécurité, réseau, finops,...)

  • Déployer et industrialiser les architectures cibles

  • Définir et proposer les modes de migration des applications

  • Veiller à la sécurité, la fiabilité et aux cycles de vie des environnements déployés

Où réaliserez-vous vos missions ? Chez des clients grands comptes de la banque, de l’assurance, de l’industrie, du retail de la Défense, du luxe ou encore de l’énergie, porteurs de projets innovants.

L’accompagnement et la formation

Pour réussir ce nouveau challenge My Devoteam Academy vous proposera des actions de formation et des certifications avec nos partenaires, mais aussi un système de parrainage et un dispositif d’évaluation personnel régulier, notamment :

  • Évoluer dans un environnement agile et ambitieux grâce au développement continu

  • S’intégrer dans les communautés technologiques 

  • Contribuer à améliorer la base de connaissances internes, les assets techniques existants et les supports de bonnes pratiques

  • Déployer votre esprit intrapreneur et créatif en identifiant des projets de transformation digitale auprès de nos clients (avant-vente, réponse à appel d’offres…).

Qualifications

Ce que vous apporterez à la Tribu ?

Diplômé.e d’une école d’ingénieurs ou d’un Master 2 en informatique, vous êtes doté.e d’un excellent relationnel, d’un sens prononcé du service et de la qualité. Vous aimez travailler en équipe, and vous parlez couramment français et anglais.

Vous avez minimum 5 années d’expériences professionnelles en tant qu’architecte IT et maitrisez  tout ou partie des technologies suivantes : 

  • conteneurisation (K8s, Docker, Swarm, Tanzu, OpenShift,...)

  • VMware (VSphere, VSAN, NSX, KVM)

  • Cloud (Azure, AWS, GCP, Alibaba Cloud et OVHcloud)

  • stockage (NAS/ SAN/ DAS) 

  • les architectures réseaux et télécoms

  • les outils tiers (Terraform, Ansible, Veeam, SCCM, PowerShell, …)

  • et vous avez un socle de connaissances confirmé en environnement Unix, Linux et/ou Windows Server. 

Vous souhaitez affirmer une trajectoire professionnelle vers des sujets d’automatisation d’infrastructure et de Cloud Privé ou hybride (AWS, Azure, GCP, OVH). Vous souhaitez développer votre sens critique en tant que consultant au regard des problématiques Cloud, des adhérences middlewares aux éléments sous-jacents des architectures du système d’information et des applications. 

[Cherry on the cake????]

Votre curiosité au sujet des risques liés à la sécurité des infrastructures virtuelles, des normes applicables (ANSSI, NIST, CIS,…) de cybersécurité serait un plus.

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

+30d

Sr. Data Engineer Azure Databricks

agileBachelor's degree5 years of experiencejiraterraformscalapostgressqloracleDesignmongodbpytestazuremysqljenkinspython

FuseMachines is hiring a Remote Sr. Data Engineer Azure Databricks

Sr. Data Engineer Azure Databricks - Fusemachines - Career Page
  • See more jobs at FuseMachines

    Apply for this job

  • +30d

    Software engineer in cyber security - Mobile bot protection, Rust

    ImpervaHybrid Remote, Stockholm, Sweden
    terraformmobileapiiosandroidAWS

    Imperva is hiring a Remote Software engineer in cyber security - Mobile bot protection, Rust

    Software engineer in cyber security - Mobile bot protection, Rust

     

    About the product

     

    Advanced Bot Protection defends mission-critical websites, mobile apps, and APIs from automated threats - bad bots - without affecting the flow of business-critical traffic.
     
    Bad bots are purpose-built to attack organizations’ websites and mobile apps through web scraping, account takeover, transaction fraud, denial of service, competitive data mining, unauthorized vulnerability scans, spam, click fraud, and web and mobile API abuse.
     
    A unique security concern, the bot problem is focused on abuse of business functionality rather than finding and exploiting vulnerabilities.

    About the team

     

    We are a team of programmers based in central Stockholm responsible for developing real-time bot detection software, data processing pipelines, and customer-facing tools. Our team works according to modern development practices and our main language is Rust. We also have frontends, and browser/mobile SDKs for Android and iOS. We operate a global infrastructure and deploy daily and we work closely with data scientists and cybersecurity threat researchers.

    About you

     

    We are now looking for a person who wants to help us in strengthening our defenses against bad bots. You have an analytical and creative mindset and can approach problems from new angles. Most likely, you enjoy exploring new technologies and use them to your advantage, rather than being heavily specialized in a few areas.
    Expectations:
    • Minimum of 5 years experience developing and delivering distributed systems
    • Solid experience and understanding of mobile devices and SDKs
    • Strong interest in Rust
    • Experience in Cloud environment, preferably AWS
    Advantage:
    • Experience with web browser technologies
    • Experience with Terraform or similar
    • Experience with cybersecurity
    Responsibilities Mobile Bot Protection:
    • Develop and maintain mobile SDK for Android and iOS
    • Support customers with SDK integration and related issues
    • Research and implement new capabilities for Mobile Bot Protection

    About the company

     

    Imperva is an analyst-recognized, cybersecurity leader—championing the fight to secure data and applications wherever they reside. Once deployed, our solutions proactively identify, evaluate, and eliminate current and emerging threats, so you never have to choose between innovating for your customers and protecting what matters most. Imperva—Protect the pulse of your business
    Check out all of our career opportunities atwww.imperva.com/Company/Careers
    Legal Notice:
    Imperva is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, ancestry, pregnancy, age, sexual orientation, gender identity, marital status, protected veteran status, medical condition or disability, or any other characteristic protected by law. 
     
     

    See more jobs at Imperva

    Apply for this job

    +30d

    Senior Infrastructure Engineer (Core)

    Telny(Remote) LATAM
    terraformDesignansibleapikuberneteslinuxpython

    Telny is hiring a Remote Senior Infrastructure Engineer (Core)

    About Telnyx

    Telnyx is an industry leader that's not just imagining the future of global connectivity—we're building it. From architecting and amplifying the reach of aprivate, global, multi-cloud IP network, to bringinghyperlocal edgetechnology right to your fingertips through intuitive APIs, we're shaping a new era of seamless interconnection between people, devices, and applications.

    We're driven by a desire to transform and modernize what's antiquated, automate the manual, and solve real-world problems through innovative connectivity solutions. As a testament to our success, we're proud to stand as a financially stable and profitable company. Our robust profitability allows us not only to invest in pioneering technologies but also to foster an environment of continuous learning and growth for our team.

    Our collective vision is a world where borderless connectivity fuels limitless innovation. By joining us, you can be part of laying the foundations for this interconnected future. We're currently seeking passionate individuals who are excited about the opportunity to contribute to an industry-shaping company while growing their own skills and careers.

    Are you passionate about building and scaling next-generation infrastructure? Do you thrive in a fast-paced environment where you can make a real impact? If so, then join our rockstar infrastructure team at Telnyx! We're building a cutting-edge, cloud-agnostic platform that spans continents and empowers our product teams to achieve amazing things.

    In this role, you'll not only collaborate with a talented team to deploy and maintain our infrastructure provisioning automation, but you'll also have the opportunity to:

    • Shape the future: We value your input! You'll collaborate with engineering teams to identify pain points and continuously improve our internal architecture for scalability and resilience.
    • Become a cloud native expert: Deepen your knowledge of service mesh, container technologies, and CI/CD pipelines.
    • Level up your skills: Learn about every technology stack Telnyx uses and become a well-rounded infrastructure engineer.

    You’d Be A Good Fit If You Have

    • 3+ years of professional software development and infrastructure operations experience
    • Strong experience in Kubernetes management and applications development. Better if you have managed on-premises clusters.
    • Proficiency on at least one programming language (Python, Golang, etc). 
    • Expert knowledge of at least one configuration language (Ansible, Puppet, Terraform, etc).
    • Experienced in shaping and improving CI/CD infrastructure design, architecture, and implementation support.
    • General knowledge of container technologies, linux networking and operating systems.
    • Candidates MUST have a good understanding of basic networking protocols like (DNS, HTTP, TLS). Knowing other networking protocols like BGP is a plus.
    • Knowledge of service discovery and service mesh architectures is a big plus.

    Growth Opportunities: 

    • Act as a strength multiplier to product engineering efforts. 
    • Learn about every technology stack used at Telnyx.
    • Work at the intersection of the social and the technical, with growth opportunities in both.

    Bring Your Authentic Self to Telnyx

    Telnyx is committed to building a team full of diverse perspectives, various backgrounds and different minds. We believe diversity drives innovation. We are committed to building a culture where difference is valued and creating avenues of equity for underserved groups. While we are still a work in progress, we are actively seeking folks who are  passionate about building a place of belonging for everyone. 

    We're looking for people with passion, grit, and integrity. We believe in transparency, proactivity, and mutual respect. We provide the high-grade tools that help you do your best work, and keep up the collaborative habits that help everyone stay in the loop. No matter where you're based or which team you’re on, you’re plugged in, supported, and helping to shape the future of communications. 

    You're encouraged to apply even if your experience doesn't precisely match the job description. Your skills and passion will stand out—and set you apart—especially if your career has taken some extraordinary twists and turns. At Telnyx, we welcome diverse perspectives, rigorous thinkers and assumption challengers. Are you ready to join us?

    See more jobs at Telny

    Apply for this job

    +30d

    Sr. Technical Program Manager, Data Platform

    agiletableaujiraterraformairflowsketchsqlRabbitMQgitc++AWS

    hims & hers is hiring a Remote Sr. Technical Program Manager, Data Platform

    Hims & Hers Health, Inc. (better known as Hims & Hers) is the leading health and wellness platform, on a mission to help the world feel great through the power of better health. We are revolutionizing telehealth for providers and their patients alike. Making personalized solutions accessible is of paramount importance to Hims & Hers and we are focused on continued innovation in this space. Hims & Hers offers nonprescription products and access to highly personalized prescription solutions for a variety of conditions related to mental health, sexual health, hair care, skincare, heart health, and more.

    Hims & Hers is a public company, traded on the NYSE under the ticker symbol “HIMS”. To learn more about the brand and offerings, you can visit hims.com and forhers.com, or visit our investor site. For information on the company’s outstanding benefits, culture, and its talent-first flexible/remote work approach, see below and visit www.hims.com/careers-professionals.

    About the job:

    We're looking for an energetic and experienced Senior Technical Program Managerto join our Data Platform Engineering team. Our team is responsible for enabling H&H business (Product, Analytics, Operations, Finance, Data Science, Machine Learning, Customer Experience, Engineering) by providing a platform with a rich set of data and tools to leverage. 

    As a senior TPM within the Data Platform team, you’ll work closely with our Product and Engineering teams to understand their roadmaps, architecture, and data. You’ll also work with our consumers of the data platform to better understand their data needs. You’ll take your passion for working with people and leveraging your technical skills to move quickly, efficiently, and decisively to connect the dots and help our team deliver.

    You Will:

    • Build strong cross-functional relationships to understand our product data and the needs/uses of data
    • Create requirements and technical specifications
    • Track and manage project risks, dependencies, status, and deliverable timelines
    • Help drive Data Platform strategies
    • Work with stakeholders to understand requirements and negotiate solutions and timelines
    • Communicate and make sure the right people have the correct information in time
    • Work within our Data Platform Engineering team to help build out ticketed work and provide details to translate requirements and benefits to that work
    • Ensure the highest business value is being delivered to our stakeholders
    • Establish mechanisms to optimize team effectiveness
    • Lead prioritization meetings and status meetings with stakeholders at a regular cadence
    • Collaborate with other technical program managers to highlight dependencies with different domains
    • You will have a bias for action, a sense of urgency, and attention to detail that makes you someone your team can instinctively trust and rally behind
    • Drive continuous process improvements and best practices to create a robust, predictable, priority-driven culture
    • Collaborate with legal to ensure data privacy and compliance are followed and implemented
    • Organize and facilitate daily stand-up, sprint planning, sprint retrospectives, and backlog grooming sessions

    You Have:

    • Minimum of 8+ years experience as a data-oriented Technical Program Manager, Technical Product Manager, or Lead capacity
    • Bachelor's degree in Computer Science, Engineering, or related field, or relevant years of work experience
    • Experience working with Data Platform Engineering teams to ship scalable data products and technical roadmaps
    • Previous experience building data platforms on the cloud using Databricks or Snowflake
    • Proficiency in Jira or other project management tools
    • Knowledge of modern data stacks like Airflow, Databricks, Google BigQuery, dbt, Fivetran
    • Ability to understand different data domains and technical requirements
    • Experience collaborating with different stakeholders such as Analytics, ML, Finance, Product, Marketing, Operations, and Customer Experience teams
    • Solid understanding of data pipelines
    • Knowledge of SQL to independently investigate and test datasets, perform data validation, sketch solutions, and create basic proofs of concept
    • Experience working with management to define and measure KPIs and other operating metrics
    • Extensive experience working on Data Security and Data Governance initiatives
    • A Foundational understanding of Amazon Web Services (AWS) or Google Cloud Platform (GCP)
    • Understanding of SDLC and Agile frameworks
    • Strong project management skills with attention to detail and experience in managing multiple projects and meeting ongoing and overlapping deadlines 
    • Bias towards over-communication
    • Team player, collaborative, and positive attitude
    • Strong leadership and communication skills
    • Excellent writing, oral, and presentation skills
    • Ability to influence without authority
    • Passion for operational excellence, attention to detail, and a demonstrated ability to deliver results in a fast-paced, high-growth environmen

    Nice To Have:

    • Experience working in healthcare 
    • Previous working experience at startups
    • A basic understanding of data streaming technologies (eg, Kafka, RabbitMQ), Git, Atlan, and Terraform is a big plus 
    • Working experience with BI tools like Tableau and Looker

    Our Benefits (there are more but here are some highlights):

    • Competitive salary & equity compensation for full-time roles
    • Unlimited PTO, company holidays, and quarterly mental health days
    • Comprehensive health benefits including medical, dental & vision, and parental leave
    • Employee Stock Purchase Program (ESPP)
    • Employee discounts on hims & hers & Apostrophe online products
    • 401k benefits with employer matching contribution
    • Offsite team retreats

    #LI-Remote

    Outlined below is a reasonable estimate of H&H’s compensation range for this role for US-based candidates. If you're based outside of the US, your recruiter will be able to provide you with an estimated salary range for your location.

    The actual amount will take into account a range of factors that are considered in making compensation decisions including but not limited to skill sets, experience and training, licensure and certifications, and location. H&H also offers a comprehensive Total Rewards package that may include an equity grant.

    Consult with your Recruiter during any potential screening to determine a more targeted range based on location and job-related factors. We don’t ever want the pay range to act as a deterrent from you applying!

    An estimate of the current salary range for US-based employees is
    $150,000$185,000 USD

    We are focused on building a diverse and inclusive workforce. If you’re excited about this role, but do not meet 100% of the qualifications listed above, we encourage you to apply.

    Hims is an Equal Opportunity Employer and considers applicants for employment without regard to race, color, religion, sex, orientation, national origin, age, disability, genetics or any other basis forbidden under federal, state, or local law. Hims considers all qualified applicants in accordance with the San Francisco Fair Chance Ordinance.

    Hims & hers is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures. If you need assistance or an accommodation due to a disability, you may contact us at accommodations@forhims.com. Please do not send resumes to this email address.

    For our California-based applicants – Please see our California Employment Candidate Privacy Policy to learn more about how we collect, use, retain, and disclose Personal Information. 

    See more jobs at hims & hers

    Apply for this job

    +30d

    Senior DevOps/Build Systems Engineer

    ProgressHybrid Remote, Sofia, Bulgaria
    agileterraformDesignazureUXrubykuberneteslinuxAWS

    Progress is hiring a Remote Senior DevOps/Build Systems Engineer

    Progress is an experienced, trusted provider of products designed with customers in mind, so they can develop the applications they need, deploy where and how they want and manage it all safely and securely. We take pride in what we do, always valuing the whole person—at work and in life. Our diverse life experiences enrich our culture because people power progress.  

    Our platform is the backbone behind billions of people worldwide chatting, flying, presenting, banking, gaming, shopping, and learning. If you're ready to make an impact, our Build and Release Engineering team is looking for talented individuals to join us in India and Ireland. 

    What You’ll Do: 

    As a vital member of our Build and Release Engineering team, you'll: 

    • Implement and enhance the entire life cycle of services, from design and inception to deployment (on-premise and cloud-based), operations, and refinement.
    • Provide support for services before they go live through system design consulting, software platform development, capacity planning, and launch reviews.
    • Maintain live services by measuring and monitoring availability, latency, and overall system health.
    • Collaborate with internal and external teams on release management activities, including the development of automated deployment and testing tools.
    • Work within an agile team, ensuring proactive communication of status and timely completion of deliverables.
    • Propose and implement continuous improvement activities.
    • Standardize and document common DevOps procedures.
    • Contribute to the development of new features and bug fixes on Progress's custom build services.
    • Practice sustainable incident response and conduct blameless postmortems, guiding ticket resolution for key applications and platforms.
    • Assist the team in diagnosing and correcting build failures.
    • Act as a mentor and learner within a team of world-class engineers.
    • Collaborate with project stakeholders, including product management, UX, other teams, and customers.

    Who You Are: 

    We're looking for someone with: 

    • Strong experience in software development using Ruby or Python.
    • Familiarity with CI/CD software such as Buildkite or Jenkins.
    • Proactive troubleshooting skills for build failures.
    • Proficiency in bash scripting.
    • Knowledge of Linux system internals.
    • Comfort with cloud-based platforms and tools like Terraform and Docker. Kubernetes experience is a plus.
    • Experience managing AWS or Azure environments.
    • An independent self-starter with a passion for learning through experimentation and research.

    We'd be happy to chat if this sounds like you and fits your experience and career goals. What we offer in return is the opportunity to experience a great company culture with wonderful colleagues to learn from and collaborate with and also to enjoy: 

     
    Compensation:    
    • Generous remuneration package
    • Employee Stock Purchase Plan Enrollment
    Vacation, Family, and Health   
    • 30 days paid annual vacation
    • An extra day off for your birthday
    • 2 additional days off for volunteering
    • Premium healthcare and dental care coverage
    • Additional pension insurance
    • Well-equipped gym on-site
    • Co-funded Multisport card
    • Daycare Center for your little ones onsite
    • Flexible working hours and work-from-home allowance
    • Free underground parking with a designated space for bikes and electric scooters
    And most importantly, great company culture with wonderful colleagues to learn from and collaborate with!   
    Apply now!   
     
    #LI-NT1
    #LI-Hybrid   

    Together, We Make Progress

    Progress is an inclusive workplace where opportunities to succeed are available to everyone. As a multicultural company serving a global community, we encourage a wide range of points of view and celebrate our diverse backgrounds. Our unique combination of perspectives inspires innovation, connects us to our customers and positively affects our communities. It is only by working together and learning from each other that we make Progress. Join us!

    See more jobs at Progress

    Apply for this job

    +30d

    Senior Machine Learning Engineer -ML Platform

    SamsaraRemote - US
    terraformscalaDesignansibleazurejavac++dockerkubernetesjenkinspythonAWS

    Samsara is hiring a Remote Senior Machine Learning Engineer -ML Platform

    Who we are

    Samsara (NYSE: IOT) is the pioneer of the Connected Operations™ Cloud, which is a platform that enables organizations that depend on physical operations to harness Internet of Things (IoT) data to develop actionable insights and improve their operations. At Samsara, we are helping improve the safety, efficiency and sustainability of the physical operations that power our global economy. Representing more than 40% of global GDP, these industries are the infrastructure of our planet, including agriculture, construction, field services, transportation, and manufacturing — and we are excited to help digitally transform their operations at scale.

    Working at Samsara means you’ll help define the future of physical operations and be on a team that’s shaping an exciting array of product solutions, including Video-Based Safety, Vehicle Telematics, Apps and Driver Workflows, Equipment Monitoring, and Site Visibility. As part of a recently public company, you’ll have the autonomy and support to make an impact as we build for the long term. 

    Recent awards we’ve won include:

    Glassdoor's Best Places to Work 2024

    Best Places to Work by Built In 2024

    Great Place To Work Certified™ 2023

    Fast Company's Best Workplaces for Innovators 2023

    Financial Times The Americas’ Fastest Growing Companies 2023

    We see a profound opportunity for data to improve the safety, efficiency, and sustainability of operations, and hope you consider joining us on this exciting journey. 

    Click hereto learn more about Samsara's cultural philosophy.

    About the role:

    The Samsara ML Experience team builds end-to-end ML applications to power different product pillars at Samsara. As a Senior Machine Learning Engineer II, you will be responsible for developing ML solutions to increase the safety, efficiency and sustainability of the physical operations. You will work closely with various engineering teams across ML, full-stack, firmware as well as cross functional partners to deliver core infrastructure, services, and optimizations.

    This role is open to candidates residing in the Canada and US except the San Francisco Bay Area (125 mi. radius from 1 De Haro St, San Francisco) and NYC Metro Area (50 mi. radius from 131 W 55th St, New York).

    You should apply if:

    • You want to impact the industries that run our world: The software, firmware, and hardware you build will result in real-world impact—helping to keep the lights on, get food into grocery stores, and most importantly, ensure workers return home safely.
    • You want to build for scale: With over 2.3 million IoT devices deployed to our global customers, you will work on a range of new and mature technologies driving scalable innovation for customers across industries driving the world's physical operations.
    • You are a life-long learner: We have ambitious goals. Every Samsarian has a growth mindset as we work with a wide range of technologies, challenges, and customers that push us to learn on the go.
    • You believe customers are more than a number:Samsara engineers enjoy a rare closeness to the end user and you will have the opportunity to participate in customer interviews, collaborate with customer success and product managers, and use metrics to ensure our work is translating into better customer outcomes.
    • You are a team player: Working on our Samsara Engineering teams requires a mix of independent effort and collaboration. Motivated by our mission, we’re all racing toward our connected operations vision, and we intend to win—together.

    Click hereto learn about what we value at Samsara. 

    In this role, you will:

    • Design and implement scalable machine learning infrastructure using Ray to support model training, deployment, and inference at scale
    • Leverage Kubernetes for orchestration of containerized applications, ensuring seamless deployment, scaling, and management of ML models and associated services
    • Develop and maintain CI/CD pipelines for automated testing, deployment, and management of ML applications and infrastructure
    • Implement robust monitoring, logging, and alerting systems to ensure high availability, performance, and security of the ML platform
    • Collaborate with data scientists and ML engineers to optimize data pipelines and model performance
    • Stay abreast of the latest advancements in machine learning technologies and infrastructure, and advocate for the adoption of best practices and new technologies within the team
    • Provide DevOps/SRE support for the ML platform, including incident response, performance tuning, and disaster recovery planning
    • Champion, role model, and embed Samsara’s cultural principles (Focus on Customer Success, Build for the Long Term, Adopt a Growth Mindset, Be Inclusive, Win as a Team) as we scale globally and across new offices

    Minimum requirements for the role:

    • BS or  MS in Computer Science or other relevant field
    • 6+ years experience as an Machine Learning Engineer or similar role
    • Strong proficiency in one or more common languages (e.g., C++, Golang, Java, Python, Scala) 
    • Proficiency with common ML tools (e.g., Spark, TensorFlow, PyTorch)
    • Experience with monitoring and logging tools (e.g., Prometheus, Grafana, ELK stack) and security best practices for ML platforms

    An ideal candidate also has:

    • Ph.D. in Computer Science or quantitative discipline (e.g., Applied Math, Physics, Statistics)
    • Strong experience with Ray for distributed machine learning, Kubernetes for container orchestration, and Docker for containerization
    • Solid understanding of DevOps and SRE principles, including experience with CI/CD tools (e.g., Jenkins, GitLab CI), infrastructure as code (e.g., Terraform, Ansible), and cloud services (AWS, GCP, Azure).

    Samsara’s Compensation Philosophy:Samsara’s compensation program is designed to deliver Total Direct Compensation (based on role, level, and geography) that is at or above market. We do this through our base salary + bonus/variable + restricted stock unit awards (RSUs) for eligible roles.  For eligible roles, a new hire RSU award may be awarded at the time of hire, and additional RSU refresh grants may be awarded annually. 

    We pay for performance, and top performers in eligible roles may receive above-market equity refresh awards which allow employees to achieve higher market positioning.

    The range of annual base salary for full-time employees for this position is below. Please note that base pay offered may vary depending on factors including your city of residence, job-related knowledge, skills, and experience.
    $135,482$227,700 USD

    At Samsara, we welcome everyone regardless of their background. All qualified applicants will receive consideration for employment without regard to race, color, religion, national origin, sex, gender, gender identity, sexual orientation, protected veteran status, disability, age, and other characteristics protected by law. We depend on the unique approaches of our team members to help us solve complex problems. We are committed to increasing diversity across our team and ensuring that Samsara is a place where people from all backgrounds can make an impact.

    Benefits

    Full time employees receive a competitive total compensation package along with employee-led remote and flexible working, health benefits, Samsara for Good charity fund, and much, much more. Take a look at our Benefits site to learn more.

    Accommodations 

    Samsara is an inclusive work environment, and we are committed to ensuring equal opportunity in employment for qualified persons with disabilities. Please email accessibleinterviewing@samsara.com or click hereif you require any reasonable accommodations throughout the recruiting process.

    Flexible Working 

    At Samsara, we embrace a flexible working model that caters to the diverse needs of our teams. Our offices are open for those who prefer to work in-person and we also support remote work where it aligns with our operational requirements. For certain positions, being close to one of our offices or within a specific geographic area is important to facilitate collaboration, access to resources, or alignment with our service regions. In these cases, the job description will clearly indicate any working location requirements. Our goal is to ensure that all members of our team can contribute effectively, whether they are working on-site, in a hybrid model, or fully remotely. All offers of employment are contingent upon an individual’s ability to secure and maintain the legal right to work at the company and in the specified work location, if applicable.

    Fraudulent Employment Offers

    Samsara is aware of scams involving fake job interviews and offers. Please know we do not charge fees to applicants at any stage of the hiring process. Official communication about your application will only come from emails ending in ‘@samsara.com’ or ‘@us-greenhouse-mail.io’. For more information regarding fraudulent employment offers, please visit our blog post here.

    Apply for this job