angular Remote Jobs

262 Results

25d

Domain Architect

NewsBank, inc.United States Remote
DesigndockerangularAWS

NewsBank, inc. is hiring a Remote Domain Architect

At NewsBank, Domain Architects coordinate and manage our technology strategy, architecture, and designs for the NewsBank’s product platform and web applications. Our massive and diverse content set includes newspapers, videos, books, government documents, maps, and more, from all over the world spanning hundreds of years. NewsBank’s web applications help a broad range of users and partners worldwide to access that content and leverage it for their needs, be it academic research, genealogical research, philanthropic giving, tracking trends, or simply keeping up with the news. Position is remote fro your home office.

Essential Duties and Responsibilities

  • Define the architectural vision and technical roadmap for the NewsBank product platform, considering scalability, performance, security, and maintainability.
  • Architect and design modular, reusable components and APIs that facilitate reusability, agility, and scale within the NewsBank product platform.
  • Evaluate and recommend appropriate technologies, frameworks, and architectural patterns to support our long-term technical strategy.
  • Establish and enforce standards, best practices, and architectural guidelines to ensure consistency and quality across software development efforts.
  • Provide technical leadership and mentorship to engineering teams, fostering a culture of innovation, collaboration, and continuous learning.
  • Lead architectural and design discussions and collaborate with engineers, and stakeholders to translate business requirements into technical solutions.
  • Responsible for building effective relationships with stakeholders and peers, as well as representing team & product needs in significant and / or cross-team initiatives.
  • Responsible for assessing web technology trends and making informed recommendations on investments (adoption, exploration, training, consultation, etc.); as well as championing and advocating for critical areas of change.
  • Stay up to date with software technology trends (designs, patterns, frameworks, and new/emerging technologies)

Qualifications

  • Highly skilled Software Architect with a proven track record of architecting, designing and developing web application software solutions.
  • Bachelor’s degree in Computer Science, Software Engineering, or a related field (or equivalent work experience).
  • At least 8 years’ experience in the software development field.
  • At least 3 years’ experience as a Software Architect, Domain Architect or Principal Engineer, with a track record of architecting and delivering complex web application designs and architectures.
  • Deep understanding of software architecture principles, design patterns, and architectural styles. Ability to envision and plan for long-term architectural needs aligned with platform goals.
  • Strong proficiency in multiple programming languages
  • Modern Web Application Development experience, targeting JavaScript/TypeScript development ecosystems. Node, React, Angular, Nest and associated tools.
  • Expertise with microservice / service-oriented architectures and designs, tools and frameworks is required.
  • Expertise in cloud computing platforms (specifically AWS) and containerization technologies (e.g., Docker, Amazon ECS).
  • Excellent communication and leadership skills, with the ability to articulate technical concepts to both technical and non-technical stakeholders. Ability to communicate and advocate for technology change when required.
  • Strong problem-solving skills and a proactive approach to addressing complex technical challenges.
  • Works and communicates effectively with developers and development leadership.
  • Works extremely well with other related teams, both technical and non-technical – User Experience, Customer Service, Product Owners, Quality Control, Technical Operations, etc.
  • Experience with large scale information retrieval is desired.
  • Experience with educational software or library software is a plus.

NewsBank, inc. has been a premier information provider for 50 years. Our comprehensive resources meet the diverse research needs of public libraries, colleges and universities, schools, military and government libraries, and professionals around the world.

Comprehensive benefits package including health, dental, life and disability insurance, 401k with company match, FSA, holidays, vacation, sick and personal paid time off.

EEO Minorities/Women/Disabled/Veterans - VEVRAA Federal Contractor

See more jobs at NewsBank, inc.

Apply for this job

26d

.NET Software Engineer, KMS Healthcare

KMS TechnologyDa Nang City, Viet Nam, Remote
agileBachelor's degreesqloracleDesignscrumc++.netmysqlcssangularjavascriptreactjs

KMS Technology is hiring a Remote .NET Software Engineer, KMS Healthcare

Job Description

  • Perform hands-on coding and code review as other peer developers as needed
  • Understand the requirements of the customer or business and utilize this knowledge to develop applications that are consistent with this;
  • Design, develop, review, implement, maintain and manage continuous integration, build management and deployment scripts, systems, and any code as required;
  • Write unit tests and run through all the test cases for assigned tasks and ensure all cases are tested and passed before release for testing.
  • Participate in Agile/Scrum activities: daily standup, demo session, retrospective, estimate, and planning, etc
  • Provide mentoring/training for junior members if any
  • Perform other tasks assigned by the Line Manager.

Qualifications

General requirements:

  • Bachelor's degree in Computer Science, Information Technology, or a related field
  • At least intermediate level of English level
  • Likely having 1+ years of experience depending on how fast of your learning and developing technical capability
  • Familiar with Agile development methodologies (Scrum, XP, Kanban)
  • Ability to obtain deep knowledge of the project technologies and work independently with minimum guidance
  • Ability to self-learn and adapt to new technologies quickly

Technical requirements:

  • Proficiency in C#, ASP.NET, .NET Core and.NET framework.
  • Strong understanding of object-oriented programming (OOP) principles.
  • Experience with database design and SQL (e.g., SQL Server, Oracle, MySQL).
  • Experience with web development technologies (HTML, CSS, JavaScript) and front-end frameworks (e.g., ReactJS, Angular, VueJS, KnockoutJS)
  • Performs effectively & independently in software implementation activities (designing, coding, verification, unit testing, integration testing, and debugging…)
  • Perform exemplary work in terms of quality and level of skill/knowledge required
  • Competent in software development processes and agile development practices
  • Recognized as a company-wide source of knowledge in software implementation
  • Has basic & discrete knowledge of software requirements and software testing
  • Experience in microservices and cloud environment (Azure/AWS/GCP) is s plus.

    See more jobs at KMS Technology

    Apply for this job

    27d

    Senior Software Engineer (ColdFusion)- Remote

    M3USAFort Washington, PA, Remote
    Bachelor's degree3 years of experiencesqloraclejquerymobileqarubycssangularAWSjavascriptbackendfrontendPHP

    M3USA is hiring a Remote Senior Software Engineer (ColdFusion)- Remote

    Job Description

    Mission:

    The Coldfusion Engineer is responsible for developing internal and external data-driven web based applications based on specifications from a project manager. This individual will also work with the project manager and QA Analyst to debug the code, put the code into production, maintain the code during its complete lifecycle, as well as go into as existing code base, understand the inter-workings of that code, troubleshoot bugs, and add new features to that code. The applications will be developed in ColdFusion, JavaScript, jQuery, HTML, CSS, and built on an Oracle database. This individual will work closely with the senior web application engineer as well as the other technology professionals and project stakeholders.

    • Develop new features in ColdFusion / MS SQL Server
    • Develop front-end in React front-end of a ColdFusion driven backend
    • Maintain current documentation for all applications supported by the developer
    • Write and debug Microsoft SQL Server stored procedures
    • Troubleshoot and resolve issues, problems, and errors encountered across our web properties, internal applications, and systems as reported or experienced.
    • Provide expertise to influence project, initiative, and maintenance technical direction during discovery, planning, and implementation stages.

    Qualifications

    • This position is player/coach and we are targeting someone with 2+ years of experience managing a small team of developers. 
    • Bachelor's degree or equivalency in a computer science related field required
    • 3 years of experience in a similar role working on web-based products.
    • Strong knowledge of ColdFusion required
    • MVC Framework knowledge very beneficial
    • Strong knowledge of SQL required
    • Strong knowledge of JavaScript beneficial
    • Knowledge and experience with other languages such as PL/SQL, Java/JSP, jQuery, HTML 4/5, CSS, PHP, Ruby, ASP.NET beneficial.
    • Familiarity with Bootstrap, React, Angular frontend frameworks beneficial
    • Familiarity with Oracle and/or other relational database experience
    • Source control/Git
    • Familiar with AWS and containers such as Kubernetes.
    • Knowledge of development for mobile devices beneficial
    • Teamwork oriented
    • Exceptional ability to multi-task and balance multiple projects and priorities
    • Ingenuity and the willingness to learn new techniques
    • Superior problem solving ability; an analytical mindset
    • Excellent interpersonal communication skills - both verbal and written

    See more jobs at M3USA

    Apply for this job

    27d

    Senior Frontend Developer

    AJ BellHybrid - WFH / Manchester OR London, United Kingdom, Remote
    agiletailwindDesignvueuiscrumcssangularjavascriptreduxfrontendNode.js

    AJ Bell is hiring a Remote Senior Frontend Developer

    Job Description

    Purpose of the Role 

    This is an exciting opportunity for a Senior Frontend Developer to join our Investcentre team and help enhancing a successful award-winning platform. You will be joining a team which has a philosophy of continuous improvement, and a strong focus on engineering excellence. 

    What does the job involve? 

    • Agile methodologies and a passion for continuous improvement and working in a high-performance engineering team  
    • Work with the team to design and deliver high quality products 
    • At AJ Bell we pair, and you, in most cases will pair with other members of the team 

    Competence, Knowledge and Skills 

    • Expertise in building modular and reusable components for Single Page Applications with one or more of the following frameworks: Angular, React, Vue, Svelte, etc. 
    • Good knowledge of JavaScript (ES5/6 and up) 
    • Experience with at least one version control tool: GitHub, BitBucket, GitLab, etc. 
    • Experience with at least one UI framework: Bootstrap, Tailwind, Material, etc, 
    • Experience of common Frontend styling paradigms: BEM, CSS modules, CSS in JS, etc. 
    • Knowledge of general Frontend tooling (particularly Node.js and npm) 
    • Knowledge of writing unit tests 
    • Knowledge and interest in asynchronous and event-based Frontend tooling: RxJS, Ngrx, Redux, etc. 
    • Knowledge and interest in writing end-to-end journey tests using tech such as Cypress, Nightwatch, Webdriverio, Protractor, etc. 
    • Knowledge and interest in Web APIs 
    • Practical experience of solving inconsistency across multiple platforms (IE11, Safari, Firefox, Chrome on Windows or Mac) 
    • Familiar with CI/CD practices 
    • Understands principles behind highly performing web pages 
    • Agile / Scrum / Kanban 
    • Strong communication skills, written and verbal 
    • Very motivated with high levels of drive and enthusiasm 
    • E-commerce and/or financial services experience 

    AJ Bell is one of the fastest-growing investment platform businesses in the UK offering an award-winning range of solutions that caters for everyone, from professional financial advisers, to DIY investors with little to no experience. We have over 484,000 customers using our award-winning platform propositions to manage assets totalling more than £72.6billion. Our customers trust us with their investments, and by continuously striving to make investing easier, we aim to help even more people take control of their financial futures.

    Having listed on the Main Market of the London Stock Exchange in December 2018, AJ Bell is now a FTSE 250 company.

    Headquartered in Manchester with offices in central London and Bristol, we now have over 1300 employees and have been named one of the Sunday Times ‘100 Best Companies to Work For’ for six consecutive years.

    There are opportunities for growth and professional development for employees wanting to progress within their career including induction training and our study support scheme which is part of our benefits package.

    There is an active programme of social events throughout the year, which are open to all employees.

    What we offer:

    • Competitive starting salary
    • Generous holiday allowance of 27 days, increasing up to 30 days with service, plus bank holidays
    • Holiday buy/sell scheme
    • Hybrid working policy
    • Casual dress code
    • Discretionary bi-annual bonus
    • Contributory pension scheme
    • Buy as you earn share scheme
    • Free shares scheme
    • Paid study support for qualifications
    • Enhanced maternity/paternity scheme from day one
    • Bike loan
    • Season ticket loan portal
    • Discounted PMI and Dental
    • Free gym
    • Paid volunteering opportunities
    • Free social events and more

    AJ Bell is committed to providing an environment of mutual respect where equal employment opportunities are available to all applicants and all employees are empowered to bring their whole self to work.

    We do not discriminate on the basis of race, sex, gender identity, sexual orientation, age, pregnancy, religion, physical and mental disability, marital status and any other characteristics protected by the Equality Act 2010. All decisions to hire are based on qualifications, merit and business need.

    Qualifications

    See more jobs at AJ Bell

    Apply for this job

    30d

    Software Engineer, Web Frameworks

    CloudflareHybrid or Remote
    Bachelor's degreeDesignapic++typescriptangularjavascriptNode.js

    Cloudflare is hiring a Remote Software Engineer, Web Frameworks

    About Us

    At Cloudflare, we are on a mission to help build a better Internet. Today the company runs one of the world’s largest networks that powers millions of websites and other Internet properties for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

    We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

    Position Location: Austin, TX | Lisbon, Portugal | London, UK

    About the Role

    Our team’s core mission is to enable developers to do what they do best — build powerful applications.  We believe they should be able to do this without having to think or worry about infrastructure, scaling, or performance. While Cloudflare Workers, Cloudflare’s solution to serverless computing, handles the infrastructure part, there’s so much more that goes into enabling developers to do their jobs. In this role you will work on a wide range of projects that enable our platform to integrate seamlessly with the existing Web development ecosystem, including developing and improving integration with full stack web frameworks, developer tools for bundling, transpiling, and performance optimizations. You’ll also be exposed to JS API design and standardization work, and development or integration of backwards/forwards compatibility API layers for Web and Node.js APIs. If this excites you, come join our team of talented engineers that enables developers all around the world to build low-latency planet-scale applications for the Internet and the Web!  

    About the Department

    Our team Frameworks and ecosystem is part of Cloudflare's Emerging Technology and Incubation (ETI) team where new, bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a successful business, ETI leverages our network to deliver entirely new tools and products to our customers. Our most successful endeavors include the Cloudflare development platform, which is composed of Cloudflare Workers, Pages, R2, D1, and many other developer products.

    What you'll do

    As a member of the Frameworks & JS APIs team, you will put yourself in the shoes of developers using our development platform and make them successful in building their applications and deploying them on to our platform by creating and improving integrations with popular web frameworks, libraries, and tools. Along the way you’ll influence the JavaScript ecosystem by participating in designing JavaScript APIs, defining design patterns and architectures, as well as surfacing optimizations, that allow developers to build applications that take full advantage of our globally distributed, low latency network.

    To this end, you will:

    • Collaborate closely with JavaScript web frameworks teams and tooling teams across the industry to ensure smooth development and production interoperability with our platform. Examples include Angular, Astro, Next, Nuxt, Qwik, Remix, Solid, SvelteKit, as well as Vite, Rollup, and many others.
    • Surface requirements and collaborate with internal teams to build features to support ecosystem integrations.
    • Contribute to open source projects across the web ecosystem in order to add features, fix issues, and improve integrations.
    • Build and improve libraries, and tools that improve ecosystem compatibility, and the getting started experience, like C3 (create-cloudflare CLI) and next-on-pages CLI.
    • Build demo applications, starter kits, and templates that enable developers to learn about our platform and get started using frameworks and libraries they are familiar with.
    • Participate in JavaScript API design efforts evolving our platform, as well as JavaScript standards.
    • Evaluate compatibility gaps between our workerd JavaScript runtime and Node.js, implement compatibility layers and polyfills to reduce developer friction when using existing libraries with our platform.
    • Contribute to internal and public-facing technical documentation, and author blog posts.
    • If applicable to ongoing projects, support the health and availability of services by being part of an on-call rotation.
    • Collaborate with engineers across Cloudflare, and contribute at many layers of the stack.
    • Leverage your creativity and developer prowess to seek out new ways to improve the platform.

    About you

    We want you to love it here! This role is a good fit for you if you are:

    • Excited by the idea of helping application developers be successful.
    • Experienced with and passionate about development tools, libraries, frameworks, and workflows.
    • Experienced in web application development, but attracted to digging a layer or two below to work on libraries, frameworks, and tools that power web application development.
    • Very experienced with JavaScript and TypeScript, web standards, JavaScript module systems, module resolution, code transformation, ASTs, and more.
    • Able to get familiar with internal architecture and workings of libraries and tools quickly, in order to propose integration strategies, or architectural adjustments.
    • Energized by mind-bending debugging sessions often involving unfamiliar code bases, complex build toolchains, and exotic bugs.
    • Excited to own your work from early discussions on.
    • Naturally curious and eager to take a step to learn something new, and share your learnings with others.
    • Above all, a collaborator and effective communicator. You want to join a team that upholds a culture of support, open and honest communication, and vulnerability, and that values collaboration over heroism. We celebrate our achievements, support each other when we make mistakes, and hold each other and our work to the highest standard.

    You’ll really feel right at home if you have:

    • Experience using the Cloudflare Workers development platform
    • Experience contributing to OSS software development or maintaining OSS projects
    • Public speaking or developer relations skills

     

    What Makes Cloudflare Special?

    We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

    Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

    Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

    Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

    1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

    Sound like something you’d like to be a part of? We’d love to hear from you!

    This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

    Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

    Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

    See more jobs at Cloudflare

    Apply for this job

    +30d

    Intern Accounts Receivable Product Engineer

    CelonisRemote, India
    sqlDesignsasshtml5javatypescriptangularpythonbackendfrontend

    Celonis is hiring a Remote Intern Accounts Receivable Product Engineer

    We're Celonis, the global leader in Process Mining technology and one of the world's fastest-growing SaaS firms. We believe there is a massive opportunity to unlock productivity by placing data and intelligence at the core of business processes - and for that, we need you to join us.

    The Team:

    In our AR team at Celonis, we prioritize the timely collection of payments, fostering client relationships, and maintaining financial integrity. Much like Celonis’ Execution Applications tailored for specific business needs, we optimize our daily operations. Automation through Action Flows is key to driving value realization, mirroring our commitment to efficiency and excellence.

    The Role:

    As a Product engineer, you will be working along with Sr. team members member of development (frontend + backend) on the Accounts Receivables(AR) Product Development, implementing features and functionality of the AR execution App. Your work at Celonis will directly impact companies and people around the globe as they improve their processes to save money, reduce waste, improve automation, and generally become more efficient. 

    If you are looking to be challenged in the front end and build solutions that scale, Celonis is the environment for you to thrive. There are a variety of tech stacks at Celonis, including but not limited to Angular, Typescript, HTML5, SASS, Python, Java, Vertica DB, and more. We focus on building beautiful, extensible, performant, and reliable applications.

    The work you'll do:

    • Design and implement new user-facing features, visual components, and performant and scalable microservices
    • Write clean, understandable, and testable code
    • Manage individual project priorities, deadlines, and deliverables
    • Can solve complex problems with limited supervision
    • Document development procedures, concepts, and knowledge
    • Build, launch, and maintain features in production
    • Help define a fun and inclusive engineering culture  

    The qualifications you’ll typically need:

    • Pursuing Bachelor/Master's degree in IT or Computer Eng. or equivalent practical experience
    • Should have good Aptitude, Analytical and Logical skill
    • Optional but good to have knowledge or experience of following technology stacks 
      • Frontend: Angular, TypeScript/JavaScript, HTML5, CSS/SCSS
      • Basic SQL Skills
      • Server: Java - Spring (boot), Python, NodeJS
      • Able to develop good REST APIs
    • Good communication and excellent collaboration skills
    • Passionate to learn and grow as a software engineer
    • Adaptable, result-oriented

    What Celonis can offer you:

    • The unique opportunity to work with industry-leading process mining technology
    • Investment in your personal growth and skill development (clear career paths, internal mobility opportunities, L&D platform, mentorships, and more)
    • Great compensation and benefits packages (equity (restricted stock units), life insurance, time off, generous leave for new parents from day one, and more)
    • Physical and mental well-being support (subsidized gym membership, access to counseling, virtual events on well-being topics, and more)
    • A global and growing team of Celonauts from diverse backgrounds to learn from and work with
    • An open-minded culture with innovative, autonomous teams
    • Business Resource Groups to help you feel connected, valued and seen (Black@Celonis, Women@Celonis, Parents@Celonis, Pride@Celonis, Resilience@Celonis, and more)
    • A clear set of company values that guide everything we do: Live for Customer Value, The Best Team Wins, We Own It, and Earth Is Our Future

    About Us

    Since 2011, Celonis has helped thousands of the world's largest and most valued companies deliver immediate cash impact, radically improve customer experience and reduce carbon emissions. Its Process Intelligence platform uses industry-leading process mining technology and AI to present companies with a living digital twin of their end-to-end processes. For the first time, everyone in an organisation has a common language about how the business works, visibility into where value is hidden and the ability to capture it. Celonis is headquartered in Munich (Germany) and New York (USA) and has more than 20 offices worldwide.

    Join us as we make processes work for people, companies and the planet.


    Celonis is an equal opportunity employer. We celebrate diversity and are committed to creating an inclusive environment for all employees. Different makes us better.

    Accessibility and Candidate Notices

    See more jobs at Celonis

    Apply for this job

    +30d

    Engineering Manager

    kotlinDesignmongodb.netdockerkubernetesangularbackendfrontend

    IPS- Integrated Practice Solutions is hiring a Remote Engineering Manager

    Engineering Manager - IPS- Integrated Practice Solutions - Career PageYour teams are motivated and inspir

    See more jobs at IPS- Integrated Practice Solutions

    Apply for this job

    +30d

    Ingénieur DevOps (H/F)

    CITECHPuteaux, France, Remote
    sqljavaangularpython

    CITECH is hiring a Remote Ingénieur DevOps (H/F)

    Description du poste

    ???????? Vous aurez les missions principales suivantes : ????????

    ???? Assurer la disponibilité des environnements projet (hors production)
    ???? Participer à l'analyse et recherche d'axes d'optimisation de performance des actes TP ou Batch  
    ???? Etre moteur sur la capacité d'outiller nos tâches quotidiennes
    ???? Participer à la mise en place de sonde automatisée sur la QOS de environnements projets
    ???? Etre force de proposition alimentant l'amélioration continue et l'expérimentation d'innovation
    ???? Communiquer un reporting hebdomadaire des actions, alertes, et travaux planifiés

    Qualifications

    ????De formation supérieure en informatique, vous avez une expérience reconnue de 5 ans avérée dans l'écosystème d'une architecture multi tiers, dont 1 an dans la configuration des pipeline automatisée (gitlab_ci) dans un contexte Kubernetes.

     ⚙️ Les compétences attendues sont les suivantes :

    ☑️ Vous avez été confronté aux exigences de performance et dans un contexte des technologies impliquées dans l’architecture client : Unix, Microservice, Devops, Java, Angular, SQL, Python, Traitement nocturne, Base de donnée, Monitoring Dynatrace.
    ☑️ Une expérience sur Keycloak / Active Infinite serait un plus pour la mission.

    See more jobs at CITECH

    Apply for this job

    +30d

    Senior Frontend Engineer

    BloomreachBratislava, Slovakia/Prague, Czech Republic/Brno, Czech Republic (Remote CEE)
    remote-firstDesignswiftuiapiUXgitc++typescriptcssangularjavascriptfrontend

    Bloomreach is hiring a Remote Senior Frontend Engineer

    Bloomreach is the world’s #1 Commerce Experience Cloud, empowering brands to deliver customer journeys so personalized, they feel like magic. It offers a suite of products that drive true personalization and digital commerce growth, including:

    • Discovery, offering AI-driven search and merchandising
    • Content, offering a headless CMS
    • Engagement, offering a leading CDP and marketing automation solutions

    Together, these solutions combine the power of unified customer and product data with the speed and scale of AI optimization, enabling revenue-driving digital commerce experiences that convert on any channel and every journey. Bloomreach serves over 850 global brands including Albertsons, Bosch, Puma, FC Bayern München, and Marks & Spencer. Bloomreach recently raised $175 million in a Series F funding round, bringing its total valuation to $2.2 billion. The investment was led by Goldman Sachs Asset Management with participation from Bain Capital Ventures and Sixth Street Growth. For more information, visit Bloomreach.com.

     

    Do you love frontend development and are you good at it? Would you like to build a large-scale & fast evolving app using Angular & TypeScript? Would you like to talk about why we might be the best team for you to join right now?? Curious? Read on!
    (Your s
    alary starts from 3300€ per monthwith stock options and other benefits included. Working in one of ourCentral Europe offices or from homeon afull-time basis.)

    What tech stack do we have for you?

    • Typescript and Javascript
    • Angular
    • SCSS/CSS
    • NodeJS
    • RxJS
    • Karma/Jasmine/Cypress
    • GIT

    About your role and the team:

    We are a team of thirteen people at the moment. We cooperate tightly as a single unit on a multitude of tasks and challenges in order to make our application the best to serve our customers’ needs. Since not all of us enjoy tasks with a focus on styling, a subteam of stylers has been formed that takes care of our UI library of low-level components. 

    We are facing a variety of tasks on our daily basis that fall mostly into three categories - designing and developing new features, maintaining existing features in the underlying codebase and sometimes prototyping new features as POCs.

    What we expect of the candidate:

    Must have

    • advanced TypeScript (or JavaScript with a strong will to switch to TypeScript)
    • advanced Angular (or similar component-based framework with a strong will to switch to Angular)
    • experience with software design & architecture (be able to propose and implement an effective & efficient solution based on problem definition without detailed instructions)
    • The ability to work in project teams effectively, being reliable and communicating clearly.
    • A “can-do” attitude

    Should have

    • experience with developing bigger projects
    • At least an intermediate skill with SCSS / CSS (be able to get things done in reasonable quality if your styler colleagues are busy)

    Preferably have

    • experience with testing (Karma, Jasmine, Cypress)
    • experience with RxJS

    Nice have

    • experience with mentoring less experienced colleagues

    How we work:

    Our entire engineering team works in 6 week cycles. Each developer is assigned to one or more projects during this cycle and aims to deliver the project together with other project team members from various other teams. In addition to working on projects, we also focus on other tasks - not limited to working on our backlog, providing an L3 support to our client facing colleagues or making improvements to our product through an initiative called “Happy consultants”.
    In order to keep our high quality standards, each change in code we do gets reviewed and our automated pipeline builds these changes, runs a series of tests, runs the linter, packages the outputs and deploys them onto a development environment.
    We are a team of diverse skill sets - you will need to share your experience and knowledge (during code reviews and ideally also beyond) with other colleagues and help them grow just like we all will help and support you from the minute you join us.

    Challenges:

    Here are some of the challenges that kept us busy in the past:

    • Micro frontend research
      • Our application is split up into modules but we are experimenting with the idea of loosening up the coupling even a bit more and splitting our large application into a collection of smaller ones run under a single container application.
      • Identify the pros and cons of this approach and what problems will it solve effectively and what other problems it might bring.
      • Take into account how this switch potentially affects not the architecture alone but also the execution, deployment and DX.
    • Optimizing build performance
      • The larger an application gets, the more complex the build becomes. Our application consists of hundreds of components, directives, services, pipes and other functions.
      • Find a way to optimise the build in order to make the DX and the pipeline build performance better.
    • Optimizing change detection
      • Our application aims to deliver a swift interaction experience to its users without the feeling that something is lagging.
      • Identify components that are underperforming.
      • Analyze their bottlenecks using the profiler.
      • Optimize the runtime performance of the problematic code parts.
    • Data visualisation
      • Our real-time analyses like trends, funnels, reports, and segmentations allow users to gain insights about their data from multiple perspectives. We integrate with external data sources spanning multiple relational databases and big data storage systems.
      • Build an interface for users to query data from data sources located outside of the Engagement to build the basis for our analyses and visualizations.
      • Create complex data visualizations using the Highcharts library or similar suitable tool.
      • Be proactive in proposing solutions which will help users to better understand their data.
      • Improve test quality and extend test coverage.
    • Extend UI library
      • We have created a mature UI library with the goal in mind to unify the look, behavior, and the API of our reusable components. This library already consists of a solid foundation of components but the innovation in the Engagement goes hand in hand with the need to create new components and enhance existing ones.
      • Create new reusable components while focusing on clear API, stability, best possible UX and modern browser support.
      • Test your component well. Use unit tests to cover all thinkable and unthinkable scenarios your component may go through to make it robust.
    • Other than that…
      • We work hard to have sustainable code, but we still have some code in our codebase, especially from the early startup era, that was written in haste to keep the business running - you will need to be able to get around in complex code and help us refactor it.
      • Automated testing of our code is important to us. You will need to cover your code, help us improve existing test quality and extend overall test coverage - spanning from unit tests, through integration tests to automated e2e tests.

    Regional benefits:

    • Monthly lunch entitlement by up to 110€ per month
    • Pension scheme or Health insurance depending on region

    #LI-DU1

    More things you'll like about Bloomreach:

    Culture:

    • A great deal of freedom and trust. At Bloomreach we don’t clock in and out, and we have neither corporate rules nor long approval processes. This freedom goes hand in hand with responsibility. We are interested in results from day one. 

    • We have defined our5 valuesand the 10 underlying key behaviors that we strongly believe in. We can only succeed if everyone lives these behaviors day to day. We've embedded them in our processes like recruitment, onboarding, feedback, personal development, performance review and internal communication. 

    • We believe in flexible working hours to accommodate your working style.

    • We work remote-first with several Bloomreach Hubs available across three continents.

    • We organize company events to experience the global spirit of the company and get excited about what's ahead.

    • We encourage and support our employees to engage in volunteering activities - every Bloomreacher can take 5 paid days off to volunteer*.
    • TheBloomreach Glassdoor pageelaborates on our stellar 4.6/5 rating. The Bloomreach Comparably page Culture score is even higher at 4.9/5

    Personal Development:

    • We have a People Development Program -- participating in personal development workshops on various topics run by experts from inside the company. We are continuously developing & updating competency maps for select functions.

    • Our resident communication coachIvo Večeřais available to help navigate work-related communications & decision-making challenges.*
    • Our managers are strongly encouraged to participate in the Leader Development Program to develop in the areas we consider essential for any leader. The program includes regular comprehensive feedback, consultations with a coach and follow-up check-ins.

    • Bloomreachers utilize the $1,500 professional education budget on an annual basis to purchase education products (books, courses, certifications, etc.)*

    Well-being:

    • The Employee Assistance Program -- with counselors -- is available for non-work-related challenges.*

    • Subscription to Calm - sleep and meditation app.*

    • We organize ‘DisConnect’ days where Bloomreachers globally enjoy one additional day off each quarter, allowing us to unwind together and focus on activities away from the screen with our loved ones.

    • We facilitate sports, yoga, and meditation opportunities for each other.

    • Extended parental leave up to 26 calendar weeks for Primary Caregivers.*

    Compensation:

    • Restricted Stock Units or Stock Options are granted depending on a team member’s role, seniority, and location.*

    • Everyone gets to participate in the company's success through the company performance bonus.*

    • We offer an employee referral bonus of up to $3,000 paid out immediately after the new hire starts.

    • We reward & celebrate work anniversaries -- Bloomversaries!*

    (*Subject to employment type. Interns are exempt from marked benefits, usually for the first 6 months.)

    Excited? Join us and transform the future of commerce experiences!

    If this position doesn't suit you, but you know someone who might be a great fit, share it - we will be very grateful!


    Any unsolicited resumes/candidate profiles submitted through our website or to personal email accounts of employees of Bloomreach are considered property of Bloomreach and are not subject to payment of agency fees.

     #LI-Remote

    See more jobs at Bloomreach

    Apply for this job

    +30d

    Tech lead Full Stack

    DevoteamRabat, Morocco, Remote
    agileDesignmongodbsassgitjavadockerpostgresqlmysqltypescriptcsskubernetesangularAWSjavascript

    Devoteam is hiring a Remote Tech lead Full Stack

    Description du poste

    LES MISSIONS DU DEVELOPPEUR FULL-STACK JAVA/ANGULAR

    • Vous interviendrez sur les nombreux projets et problématiques de nos clients,
    • Vous participerez activement aux phases projet (analyse/développement, mise en place
      et livraison) en proposant des solutions.
    • Vous réaliserez “from scratch” des projets,
    • Vous adresserez les problématiques d’architecture, de testabilité, de maintenabilité en
      proposant des solutions,
    • Nous partagerons les bonnes pratiques et sujets innovants quotidiennement,
    • Nous apprendrons grâce à vous et vous apprendrez de nous,
    • Vous participerez à la vie du pôle web (BBL, crossDT, soirée technique, …),

    LE CADRE DU DEVELOPPEMENT FULL-STACK JAVA/ANGULAR

    •  Java 10+ (Spring Boot, Spring Security, Spring JPA, Spring Data, Maven, Gradle), J2EE,Hibernate.
    • JavaScript (TypeScript, Angular 6+), SASS, Karma, Jasmine.
    • PostgreSQL, DynamoDB. MongoDB, MySQL, MS Server, H2.
    • AWS, Google Cloud, Microsoft Azure.
    • Git, Docker (Swarm, Rancher, Kubernetes, Compose).
    • Architecture SOA, WOA, Microservices.
    • Nous opérons dans un cadre de Devops (CI/CD), de la manière la plus agile possible.

    Qualifications

    De formation Bac+5, d’une École d’Ingénieur ou équivalent, tu es non seulement capable d’apprendre et de réaliser des développements en technologies web innovantes mais aussi de comprendre, débugger et maintenir des bases de code moins récentes.

    Tu sais prendre du recul sur tes réalisations et celles de tes collègues, ainsi que proposer et mettre en places des améliorations. La qualité, la robustesse, l’optimisation et les performances, ainsi que la précision de l’interface sont des concepts qui importent pour toi.

    Nous recherchons des personnes ayant déjà +5 années d’expérience en développement Java et Angular, ainsi qu’en intégration graphique & responsive design (HTML, CSS), et qui ont l’envie d’intervenir sur des projets ambitieux et de partager leur passion.

    Alors si tout ceci te correspond, si tu souhaites progresser et produire, apprendre et partager, rejoins-nous !

    See more jobs at Devoteam

    Apply for this job

    +30d

    Senior Full Stack Software Engineer - Cloud Applications

    JitterbitSão Paulo, Brazil, Remote
    DesignapijavadockerelasticsearchmysqltypescriptcsskuberneteslinuxangularAWSjavascriptNode.js

    Jitterbit is hiring a Remote Senior Full Stack Software Engineer - Cloud Applications

    Job Description

    Jitterbit is seeking a Senior Full Stack Software Engineer to join our Cloud Applications team. Jitterbit is an iPaaS (Integration as a Service) and API Management platform who has been recognized in the leader quadrant of Gartner for five straight years. Our customers use our iPaaS and APIM platform to solve mission critical business problems. What is our challenge? To make it easy to integrate our customers’ systems. In order to do this, we need to build and create a SaaS offering that is reliable, stable, and scalable for our customers. Do you have the design, architecting, and code-writing capabilities to take on this challenge? And can succeed in a big way?

    ABOUT THE TEAM

    The engineering team at Jitterbit believes that the quality of our code reflects directly on us as professionals. We are relentless about crafting a product that is innovative and delivers a memorable user experience; an experience that is fast and robust. As a key engineer on our team, you will collaborate with other engineers, product management, and operations. Our culture is fun, fast-paced, performance-oriented, open, and collegial. We are constantly pushing the technology envelope to the edge! We are very distributed and our culture is set up to make all of us very effective working remotely. We believe in hiring talent where it exists.

    ABOUT THE JOB

    You will be helping us build, design, and architect awesome and new capabilities on our various Cloud Application products. We are looking for a senior full stack engineer. You will be working with Angular, TypeScript, Node.js, CSS3, Nginx, Tomcat, Kafka, Elasticsearch, MySQL, Linux, Docker, and Kubernetes; to name a few of the technologies we use in our Cloud Apps team. You will have full lifecycle responsibilities to create robust, scalable, and distributed systems that operate flawlessly 24x7x365. You will have an opportunity to learn new things. We’re always expanding into new areas, exploring new technologies and pushing the frontier of our platform.This is an exciting opportunity to work in a highly innovative environment with new technologies as we continue to extend our market leading position.

    Qualifications

    ABOUT YOU

    You are an engineer who can turn ideas into extremely reliable and scalable designs. You code in such a way that other engineers find your code easy to comprehend, modify, and build upon. You believe in the power of Integration and APIs to transform how systems are integrated and how applications are built.

    You will be successful in this role if you:

    • Enjoy helping and mentoring others around you as you grow and become a successful engineer and developer
    • Have excellent written and verbal communication skills
    • Are capable of working in a distributed team and able to excel in a remote culture
    • Are self-driven and able to work on key initiatives
    • Take pleasure in making things happen and listen to the input from peers
    • Are able to make data driven decisions
    • Are a believer in a best idea strategy regardless of where or who ideas come from

    We are looking for:

    • 5-8+ years of experience in building large scale distributed applications.
    • Strong experience building multi-tenant SaaS applications
    • Strong problem-solving, debugging, and analytical skills with great attention to detail
    • Experience with Microservices and Cloud-based architectures/design patterns

    Technical Skills and Experience:

    • Excellent JavaScript, CSS and HTML authoring skills.
    • Proficiency with Javascript, TypeScript, Java Node.js, or Go.
    • Familiar with application deployment via Docker and/or Kubernetes.
    • Hands-on experience with AWS services such as DynamoDB, S3, or CloudFront.
    • Bonus: Experience using DataDog APM and logging.
    • Bonus: Experience developing and releasing using CI/CD pipelines, such as GitHub Actions

    See more jobs at Jitterbit

    Apply for this job

    +30d

    SDET/Test Automation QA Engineer

    SonderMindDenver, CO or Remote
    agilepostgresscrumapiqagitrubyc++elasticsearchtypescriptangularjenkinsAWSjavascript

    SonderMind is hiring a Remote SDET/Test Automation QA Engineer

    About SonderMind

    At SonderMind, we know that therapy works. SonderMind provides accessible, personalized mental healthcare that produces high-quality outcomes for patients. SonderMind's individualized approach to care starts with using innovative technology to help people not just find a therapist, but find the right, in-network therapist for them, should they choose to use their insurance. From there, SonderMind's clinicians are committed to delivering best-in-class care to all patients by focusing on high-quality clinical outcomes. To enable our clinicians to thrive, SonderMind defines care expectations while providing tools such as clinical note-taking, secure telehealth capabilities, outcome measurement, messaging, and direct booking.

    To follow the latest SonderMind news, get to know our clients, and learn about what it’s like to work at SonderMind, you can follow us on InstagramLinkedin, and Twitter

    About the Role

    As an SDET/Test Automation QA Engineer, you will have a passion for successfully developing robust and scalable testing frameworks to continuously improve quality, reduce cycle time, and bake efficiency into our development and testing processes. You will work closely with Product and Support teams to consistently advocate for end-users by ensuring the SonderMind platform is stable and meets the functional requirements. You strive for quality releases and exceeding customer expectations.    

    Essential Functions 

    • Create and maintain automated and manual test cases
    • Assist with any manual testing needs on the team
    • Participate and have input on QA direction discussions; own the QA processes on the team 
    • Accountable for testing all stories coming through the team
    • Work with other SDET’s and Manual testers to ensure cross team projects are thoroughly tested
    • Work closely with engineers  to understand the underlying architecture in the code to create more robust tests.

    What does success look like?

    • Quickly integrates into the team and becomes familiar with tools, process, and culture of existing software development and testing life cycles. Tests while leveraging existing scripts and adds to and/or makes recommendations for improvement.
    • Start build and implementation of go-forward test automation framework(s).
    • Well versed in our go-forward automated testing strategy. Fully understands system architecture, business functionality and technical dependencies. The test automation framework is stable, reusable, and positively growing code coverage.

    Who you are?

    • 4+ years of software test development experience with proficiency in Javascript, Typescript, or similar 
    • Experience in Unix scripting or equivalent command line tools 
    • Experience with designing and developing full stack test automation ( Protractor, Cypress, etc)  
    • Proficiency with continuous integration and continuous deployment pipelines and tools  (Gitlab CI, CircleCI, Jenkins)
    • Testing and automating RESTful API service calls via tools such as Postman, Bruno, or similar
    • Ability to lead creation and maintenance of advanced suites of automated scripts for the full stack
    • Source control, Git experience
    • Experience in communicating quality reporting and metrics of test execution results, including use in visibility dashboards
    • Strong understanding of SDLC processes specifically agile scrum methodology

    Preferred Experience 

    • Test case management systems, including creating integrations with one 
    • Load & Performance Test Engineering
    • Demonstrated experience in designing automation creating modular test scripts for reuse
    • Coding or working familiarity with any of the following technologies: Angular, AWS Deployment , ElasticSearch, Unit testing RSpec, Jasmine or similar experience, Ruby on Rails, Postgres, Redis

    Our Benefits 

    The anticipated salary rate for this role is between $114,000-130,000 per year.

    As a leader in redesigning behavioral health, we are walking the walk with our employee benefits. We want the experience of working at SonderMind to accelerate people’s careers and enrich their lives, so we focus on meeting SonderMinders wherever they are and supporting them in all facets of their life and work.

    Our benefits include:

    • A commitment to fostering flexible hybrid work
    • A generous PTO policy 
    • Therapy coverage benefits to ensure our employees have access to the care they need
    • Competitive Medical, Dental, and Vision coverage with plans to meet every need, including HSA and FSA options
    • Employer-paid disability & AD&D to cover life's unexpected events. Not only that, we also cover the difference in salary for up to eight (8) weeks of short-term disability leave
    • Eight weeks of paid Parental Leave  (if the parent also qualifies for STD, this benefit is in addition)
    • 401K retirement plan with 100% matching on up to 4% of base salary

    Application Deadline

    This position will be an ongoing recruitment process and will be open until filled.

     

    Equal Opportunity 
    SonderMind does not discriminate in employment opportunities or practices based on race, color, creed, sex, gender, gender identity or expression, pregnancy, childbirth or related medical conditions, religion, veteran and military status, marital status, registered domestic partner status, age, national origin or ancestry, physical or mental disability, medical condition (including genetic information or characteristics), sexual orientation, or any other characteristic protected by applicable federal, state, or local laws.

    Apply for this job

    +30d

    Sr. Full Stack AI Developer

    Fortune BrandsMaumee, OH, Remote
    agileBachelor's degreejiranosqlsqloracleDesignvuemongodbazurescrumqagitc++.netdockertypescriptcsskubernetesangularpythonAWSjavascriptfrontend

    Fortune Brands is hiring a Remote Sr. Full Stack AI Developer

    Job Description

    The Sr Full Stack AI Developer will help execute Fortune Brands Innovation’s technology strategy in alignment with business needs and priorities. This role will collaborate closely with technology teams and business teams to enable our fast-paced business to grow and evolve. Working with a high-performance team, the Sr Full Stack AI Developer will focus on the timely design and delivery of initiatives using modern lean application development using .NET and AI platforms and integrated business systems.

    This is a remote position; preferred time zone is CST or EST.

    What You'll Do:

    • Utilize programming languages like React, .Net C#, SQL, and NoSQL databases, Container Orchestration services including Docker and Kubernetes, and a variety of Azure services.
    • Participate in full software lifecycle development including analysis, design, coding, testing, implementation, deployment, and support with and across Agile teams.
    • Work on innovative solutions including AI-based platform development.
    • Consistently write, translate, and code software programs and applications according to specifications.
    • Employ best practices for designing scalable, extensible, secure applications.
    • Design and develop n-tier .NET MVC web applications using the latest front-end and back-end technologies.
    • Design and develop robust RESTful APIs and micro-services for enterprise application integrations.
    • Conduct Unit/Integration tests, collaborate with DevOps, QA, and Cybersecurity teams through product releases.

    Qualifications

    What You'll Bring to the Table:

    • Bachelor's Degree required in Computer Science, Information Systems, Information Technology, or equivalent experience
    • 6+ years of experience as a full stack developer using modern web development languages
    • 4+ Years experience with the C#, Python, R
    • Proficient in web technologies including HTML, CSS, JavaScript, TypeScript
    • Experience ASP.NET Core
    • Experience with frontend frameworks such as React, Angular, Vue
    • Experience in databases such as SQL Server, Oracle, MongoDB
    • Experience with building and consuming REST APIs
    • Experience with data preprocessing, feature engineering, model training, evaluation, and deployment
    • Proven analytical and problem-solving skills

    Preferred Qualifications:

    • Experience using software versioning and release management tools (Git, Azure, Jira)
    • Experience with cloud services (Azure, AWS)
    • Knowledge of agile, scrum or lean practices
    • Prior experience building cloud-based AI applications
    • Experience with cloud platforms, especially Microsoft Azure, and familiarity with Azure AI services such as Azure Machine Learning, Azure Cognitive Services, and Azure Databricks
    • Microsoft Certifications is preferred

    The salary range for this position is $81,000 - $124,300. 

    Pay offered will vary based on job-related factors such as location, experience, training, skills, and abilities. 

    See more jobs at Fortune Brands

    Apply for this job

    +30d

    Specialist, Full Stack Developer II

    Team RubiconLos Angeles, CA OR Remote
    sqlDesignhtml5qac++.netangularjavascriptbackendfrontend

    Team Rubicon is hiring a Remote Specialist, Full Stack Developer II

    Team Rubicon (TR)is seeking aSpecialist, Full Stack Developer II. TheFull Stack DeveloperIIwill workalongsidethe rest of the Technology Department to build and updatecustom tools and products to enable Team Rubicon’s missionon a daily basis. This will requirethe ability to collaborate, plan, and execute as well asdemonstratedskills in software design andimplementation.TheFull Stack Developer IIwillbe responsible foradvanced configuration, development, implementation, testing, and deployment of web-based applications, business intelligence solutions, and integration of applications and data. 

    Evey day will be a challenge, but every month brings new opportunities for an organization that is quickly becoming a household name in disaster response. This position reports to TR’sManager, Business Applicationsand is based out of TR’s National Headquarters in Los Angeles, CA or remote within the United States.

    Duties: 

    • Software Development: Design, develop, andmaintainscalable web applications using .NET Core, Angular, and SQL technologies. 
    • Frontend Development: Implement user-friendly interfaces and user experiences using Angular framework, HTML5, CSS3, and JavaScript. 
    • Backend Development: Create robust APIs and backend services using .NET Core framework for seamless integration with frontend components. 
    • Database Management: Design andoptimizeSQL database schemas, write complex queries, and ensure data integrity and security. 
    • Code Reviews and Testing:Participatein code reviews to ensure code quality, conduct unit tests, and contribute to the overall software testing process. 
    • Documentation: Document technical specifications, architectural designs, and code implementation details for future reference and collaboration. 
    • Collaboration: Work closely with cross-functional teams including UI/UX designers, product managers, and QA engineers to deliver high-quality software solutions. 
    • Problem Solving: Troubleshoot and debug issues,identifybottlenecks, and implement effective solutions tooptimizeapplication performance. 
    • Continuous Improvement: Stay updated with industry trends, emerging technologies, and best practices in software development. Propose and implement process improvements to enhance team productivity and software quality. 

    Experience and Background:

    • Minimum of 3-5 years of professional experience in software development. 
    • Strong understanding of software development principles, design patterns, and best practices. 
    • Experience with version control systems such as Git and collaborative development tools like JIRA. 
    • Familiarity with RESTful API design and implementation, as well as microservices architecture. 
    • Soft Skills: 
      • Excellent communication and collaboration skills with the ability to work effectively in a team environment. 
      • Self-motivated with a proactive approach to learning and skill development. 

    Special Requirements: 

    • This is a full-time, hybridrole based in Los Angeles, CA(with the potential to be a remote role based anywhere within the United States) and provides a flexible & non-traditional work schedule (relocation expenses not provided).
    • This role alsoEveningand weekend schedule supporting operations and tech team[Additional requirements such as evening/weekend schedule requirement and local/other travel requirements].
    • Travel: At least 15% travel for in-person design sessions and meeting with stakeholders.

    Job Type:  

    • Full-time, salary, exempt 

    Job Tier:  

    • Specialist 

    Pay Range: 

    • $80,514.00 – $137,241.60 per year 

    Cultural Principles:   

    • Mission First, Greyshirt Always: Anyone joining TR must understand that our mission to provide disaster response comes first 
    • Step into the Arena: TR needs leaders who aren’t afraid to dare to be great  
    • Everyone Has A Role Know It: Ability to successfully navigate a fast-paced, high-growth environment and solve problems in the face of ambiguity 
    • GSD: We are entrepreneurial, resourceful and determined no matter how chaotic the situation 
    • Change Your Socks: We take care of ourselves and each other so we are best equipped to serve those in greatest need 
    • Adults Only: Every team member is an adult until proven otherwise 
    • Your Mother’s A Donor: Every leader must be committed to fiduciary responsibility, transparency and financial stewardship 

    Perks of the Team:   

    • Unlimited Flexible Paid Time Off  
    • Generous holiday schedule (including a paid week off between winter holidays)  
    • Matching 401k contributions up to 4% with no vesting requirement 
    • 100% company-paid health benefits for employees and their dependents  
    • Professional development, leadership development and events/conferences 
    • Paid time off to volunteer with the non-profit of your choice 
    • One-week all-inclusive onboarding experience 

    The health of our staff and volunteers is a top priority for Team Rubicon. We require all new employees to be fully vaccinated against COVID-19 or to obtain an approved exemption as an accommodation. If you are not willing to be vaccinated, your offer will be rescinded unless Team Rubicon approves a valid exemption and reasonable accommodation for qualifying religious or medical reasons (or for other categories protected by applicable law. This policy is intended to comply with all state and local laws, including all applicable equal employment opportunity laws. 

    Learn more about Team Rubicon: 

    Team Rubicon is an equal opportunity employer and is committed to not only including but actively seeking out a diversity of lifestyles, experiences, perspectives, and voices in order to foster inclusion, growth, and innovation. Your candidacy will be considered without regard to race, color, religion, gender, gender identity or expression, sexual orientation, national origin, genetics, disability, age, or veteran status. 

    See more jobs at Team Rubicon

    Apply for this job

    +30d

    Junior Software Engineer

    SuscoRemote
    sqlmobileazureuigitrubyjavac++c#.netlinuxangularpythonjavascriptfrontendPHP

    Susco is hiring a Remote Junior Software Engineer

    Junior Software Engineer - Susco - Career Page

    See more jobs at Susco

    Apply for this job

    +30d

    Principal Software Engineer (Frontend)

    Procore TechnologiesBangalore, India, Remote
    agileDesignvuehtml5UXrubyjavatypescriptcssangularpythonjavascriptbackendfrontend

    Procore Technologies is hiring a Remote Principal Software Engineer (Frontend)

    Job Description

    We’re looking for a Principal Software Engineer (Frontend) to join Procore’s Resource Management team. In this role, you’ll have the unique opportunity to drive the next generation of construction platform initiatives in a global SaaS infrastructure. You’ll work with our dedicated and talented team spanning Engineering, Product Management, UX and Architects to create and scale the next generation Procore experience on our web platform. You’ll bring your deep experience in Web, Backend, UI/UX, Micro Front-end to evolve our Resource Management products to a platform-oriented approach.


    As a Principal Software Engineer (Frontend), you will be primarily responsible for establishing the strategic technical direction, creating reference patterns, and will be additionally responsible for actively driving the effective execution of that strategy for one of Procore’s core product areas. This is a great opportunity to use your leadership, interpersonal, and organizational skills to build highly effective systems and practices, foster collaborative relationships, and measure value delivered to our customers.


    This position reports to the Executive Director (India) with the opportunity to be located in the Bengaluru or Pune office. We’re looking for someone to join our team immediately.
     

    What you’ll do: 

    • Plan and build, and implement scalable user interface systems that delight users for very complex construction workflows
    • Collaborate with other engineers, designers and managers to understand user pain points and refine great solutions
    • Lead code reviews and documentation, and take on complex bug fixes and architectural improvements
    • Drive the success of projects, from the technical design, implementation, and launch to operation
    • Onboard and mentor other engineers
    • Coach others how to apply architecture patterns common to the team
    • Hands-on development and coding of architecture and systems that meet the test of time for a variety of web modalities
    • Build awareness, increase knowledge and drive adoption of modern technologies, industry innovations, trends and architecture patterns, sharing customer and engineering benefits to gain buy-in
    • Collaborate with leaders across engineering, product management, UX and business stakeholders to understand strategic objectives and align technology solutions to business goals
    • Lead efforts to develop predictive capabilities for technology disruption by leveraging broad data sources
    • Establishing and maintaining our overall technology strategy which supports and enables our multi-year corporate and product strategies, and which embodies our P&T and Engineering Principles

     

    What we’re looking for: 

    • Bachelors or Masters Degree in Computer Science, a related field, or comparable work experience
    • 12+ years experience in Software Engineering, Test Driven Development and Design principles for web and full stack applications at scale with distributed architectures
    • Experience with Javascript (ES6), HTML5, CSS and experience with modern Javascript frameworks (e.g., React, AngularJS, Vue).
    • 5+ years experience working on full-stack modern applications and frameworks (Ruby on Rails, Nest.js, React, Typescript, Angular)
    • 5+ years experience in Object-Oriented Program fundamentals, Test Driven Development and Design principles (Ruby, Java, Go, NodeJS, Python)
    • Understanding of the modern frontend ecosystem, including but not limited to bundling, linting, testing and releasing.
    • Extensive experience with modern testing frameworks (e.g., Jest, Cypress, Mocha, Chai).
    • Experience designing and building software in a Service-Oriented Architecture
    • Track record of anticipating technical problems that will fall out of major projects and designing solutions to overcome those problems
    • Strong experience documenting and bringing team clarity to complex solutions
    • Time-honed expertise with modern web development across the entire spectrum of development, testing, staging, deploying, and monitoring
    • A curious mind that is driven to innovate and solve customer problems
    • Strong comfortability with the JavaScript language and ecosystem.
    • Experience in Agile software development methodologies.
    • Experience engineering software systems of medium-to-large scope and complexity.
    • Experience mentoring more junior engineers.
    • Effectively communicate with and influence key stakeholders across the enterprise, at all levels of the organization and promote a culture of engineering excellence and being well-managed, using opportunities to reuse and inner-source solutions where possible
    • Demonstrated ability to influence and drive change within the organization, promoting innovation and continuous improvement
    • Being comfortable with the overall responsibility and accountability to create and maintain a technical strategy and execution plan
    • Proven track record of distilling ambiguity to clarity and direction

    Qualifications

    See more jobs at Procore Technologies

    Apply for this job

    +30d

    Senior Software Mobile Engineer

    WondersignSan Diego, CA Remote
    agilenosqlsqlDesignFirebasemobileiosandroidelasticsearchcssangular

    Wondersign is hiring a Remote Senior Software Mobile Engineer

    Reporting Relationship: Reports to Chief Technology Officer


    General Summary

    We are seeking an experienced Senior Software Engineer with a strong background in mobile cross-platform application development using the Ionic-Capacitor framework and deep expertise in database integration and management within mobile applications. The ideal candidate will lead the design, development, and optimization of high-quality mobile applications that deliver a seamless user experience across Android, iOS, and ChromeOS platforms while ensuring data integrity, security, and performance.

    Essential Functions

    1. Architect and develop scalable, high-performance mobile applications using the Ionic Capacitor framework with a strong focus on database integration, data synchronization, and offline-first capabilities.
    2. Work closely with cross-functional teams to understand business requirements and translate them into technical specifications, ensuring efficient data storage, retrieval, and manipulation within mobile applications.
    3. Design and implement robust schemas in APIs for secure and efficient data access and manipulation, leveraging SQL and NoSQL databases.
    4. Optimize application performance with a focus on recent data interactions, implementing caching, data compression, and efficient querying techniques for real-time data processing.
    5. Ensure data security and compliance with legal regulations by integrating advanced encryption techniques and secure data storage solutions.
    6. Collaborate with UI/UX designers and product managers to create intuitive and responsive applications, ensuring seamless data integration and synchronization across platforms and devices.
    7. Contribute to researching technologies and rapid prototyping.
    8. Lead the development team through the entire application lifecycle, from concept to deployment, emphasizing best practices in database management and application development.
    9. Provide technical leadership and mentorship to junior engineers, fostering a culture of innovation, excellence, and continuous improvement.
    10. Stay up-to-date with the latest trends and technologies in mobile development and database management, evaluating and incorporating them into our projects to enhance functionality and user experience.
    11. Oversee the deployment process, including application configuration, and app store submission, ensuring seamless delivery and operation of mobile applications.


    Requirements

    1. 5+ years of experience in hybrid mobile application development, with a significant focus on database design, integration, and optimization in a mobile context.
    2. Proficiency in the Ionic Capacitor framework with extensive knowledge of web technologies like HTML, CSS, JavaScript/TypeScript, and Angular framework.
    3. Expertise in database technologies like SQLite, Firebase, Realm, and experience with RESTful APIs and JSON for mobile applications.
    4. Understanding of native mobile development for Android and iOS is highly desirable.
    5. Demonstrated expertise in implementing search functionalities within mobile applications, including but not limited to, full-text search and fuzzy search, utilizing technologies like Elasticsearch, Algolia, or similar.
    6. Strong analytical problem-solving and project management skills with the ability to lead a development team in a fast-paced agile environment.
    7. Excellent communication skills, capable of mentoring junior engineers and collaborating with cross-functional teams.
    8. BS Degree preferably in Computer Science or Information Systems.

    Other Duties:

      Please note this job description is not designed to cover or contain a comprehensive listing of activities, duties or responsibilities that are required of the employee for this job. Duties, responsibilities and activities may change at any time with or without notice.

      Here's How We Work:

      Offering Freedom & Flexibility.
      For the most part we're a distributed team working from around the globe (with offices in San Diego, CA and Tampa, FL). We give our team members a high degree of freedom with options for remote work. As a team we take full ownership for our results.

      Tackling Exciting Challenges. The retail landscape is undergoing major changes. We come up with new ways brands and retailers can navigate these shifts in consumer behavior to weather the commerce evolution. Then we turn these ideas into beautiful, smart software.

      Taking Ownership.We don't accept the status quo and we challenge ourselves, our processes, our services and each other to deliver the best possible experience.

      Being Truthful & Inclusive. We are transparent in our decisions and our communication, and we value and respect feedback from any source, whether internal or external. We only win as a team, and we understand that everyone needs to stay involved, be empowered, and held accountable.

      Perks & Benefits:

      • Attractive compensation and PTO policy
      • Short and long term disability insurance
      • Life insurance
      • Company supports professional development for all team members
      • Latest technology, equipment and software you need to do your job

      Physical Demands/Work Environment:

      The physical demands described here are representative of those that must be met by an employee to successfully perform the essential functions of this job. Reasonable accommodations may be made to enable individuals with disabilities to perform the essential functions.

      Essential Physical & Mental Requirements

      • This position will require the following physical requirements; sitting (75%), walking (15%), standing (10%), lifting up to 10 pounds.
      • This position will require the following mental requirements; Ability to reason through problems to reach solutions, troubleshooting ability, effective written and verbal communications skills and ability to see, type, speak on phone and work with various departments within the company.

      Additional Physical & Mental Requirements

      • This position will require the following mental requirements; while performing the duties of this job, the employee is regularly exposed to high pressure to high-stress situations. Employee works in a typical office environment and is occasionally exposed to moving mechanical office equipment. The noise level in the work environment is usually moderate. Some travel to job sites and/or offices is required. Must be able to travel and work extended schedule as needed.

      Interested? Submit your resume and any supporting paperwork today! For more information please visit www.wondersign.com

      See more jobs at Wondersign

      Apply for this job

      +30d

      Adobe Experience Manager CMS Architect

      MuteSixAlexandria, VA, Remote
      DesignazureuijavadockercsskubernetesangularAWSjavascript

      MuteSix is hiring a Remote Adobe Experience Manager CMS Architect

      Job Description

      Isobar Public Sector is seeking an Adobe Experience Manager (AEM) CMS Architect who has recent digital experience with AEM and the AEM suite of products, including sites, assets, and forms. The candidate should have experience architecting on-premise as well as cloud installations of AEM. The candidate should have experience with DevSecOps practices and tooling, including the use of these toolsets for AEM website builds and deployments. The candidate should be a strong Java developer capable of creating technical designs and architectures, as well as have expertise in setting up and configuring AEM. The ideal candidate will have a deep understanding of AEM capabilities, best practices, and integration with other enterprise systems.

      Isobar works with U.S. federal government agencies on some of the most advanced projects in the world today. Our work has real-world impacts, including supporting our service members with their missions, workforce improvements, and improving the citizen experience with government services. Join our team and practice state-of-the-art DevSecOps development on projects that MATTER. Learn the latest technologies and processes and apply them with military-grade cybersecurity.

      What You’ll Do 

      • Design scalable and robust AEM solutions that align with business objectives and technical requirements. Define architecture patterns, components, and integrations to ensure optimal performance, security, and maintainability. 
      • Lead the technical team in the installation, configuration, and implementation of the AEM product suite solution in a secure cloud hosting environment.  
      • Lead the development and customization of AEM components, templates, workflows, and integrations using best practices and industry standards. Provide guidance to development teams on AEM development techniques and methodologies. 
      • Ensure that AEM solutions comply with security standards, data privacy regulations, and industry best practices. Implement security controls, authentication mechanisms, and encryption protocols to protect sensitive data. 
      • Interact with clients to create end-to-end specifications for content and collaboration solutions. 
      • Design and implement customer engagement strategies to support multi-site, multi-channel, multi-lingual delivery environments. 
      • Develop digital consumer experiences and content-driven applications based on the foundational AEM product. 
      • Define implementation processes, quality gates, and standards. 
      • Define best practices to manage performance and scalability of the content management and content delivery solution. 
      • Diagnose and solve technical problems related to content management implementation. 
      • Adopt and utilize iterative/Agile methodology as needed or requested. 

      Who You Are 

      • A US Citizen who possesses a security clearance (or be eligible to obtain one). 
      • Residency in the US required due to clearance requirements.  
      • 8+ years’ experience implementing solutions with one or more web content management systems. 
      • 3+ years’ experience implementing solutions using Adobe AEM within the DoD is highly preferred. 
      • Bachelor’s degree or higher in Computer Science or Engineering. 
      • Strong proficiency in Java/J2EE, Apache Sling, OSGi, HTML, CSS, JavaScript, and related web technologies. 
      • Solid understanding of RESTful web services, SOAP, JSON, XML, and other integration technologies. 
      • Experience with cloud platforms (e.g., Adobe Experience Cloud, AWS, Azure) and containerization technologies (e.g., Docker, Kubernetes) is a plus. 
      • Proven experience with AEM architecture and configuration including multi-site deployments, site optimization, performance tuning, testing, solution design and troubleshooting. 
      • Proven experience as an AEM Developer, including custom component development and integration with an AEM platform. 
      • Strong proficiency in Java, HTML, JavaScript, and other relevant technologies used in AEM development. 
      • Familiarity with JavaScript frameworks (e.g., Angular, React) and their integration with AEM. 
      • Experience with AEM Core Components and AEM Touch UI development. 
      • Knowledge of AEM administration, including user permissions, configurations, and system maintenance. 
      • Understanding of software development methodologies, version control systems, DevSecOps, and CI/CD processes. 
      • Excellent analytic and problem-solving skills with ability to work effectively in a collaborative team environment. 
      • Strong communication and interpersonal skills, with the ability to effectively convey technical concepts to both technical and non-technical stakeholders. 

      Who We Are 

      We are trusted digital navigators delivering customer-centric solutions to the US Government, Public Sector, and Educational Institutions. We utilize human-centered design, emerging technology, and data-driven transformation to formulate digital solutions to deliver on our client’s modernization goals and improve mission performance.

      We put our people first, above all else. We lead authentically and believe investing in our people is the key to our success. In doing so, we enable purposeful collaboration with our people, stakeholders, and clients, successfully striving for dynamic growth and intentional progress.

      Here are some of the benefits that accompany full-time employment at Isobar: 

      • We offer flexible time off for vacation and personal time. We believe in treating adults like adults and allowing for open communication between team members and their supervisors to determine proper timing and coverage. 
      • In addition to 16 recognized holidays, our offices are closed the last week in December. This adds up to 21 paid company holidays. 
      • Multiple levels of offerings for medical and dental, including a covered membership fee to exceptional primary care through One Medical. 
      • Other miscellaneous benefits like Short-Term and Long-Term Disability at no cost, company-covered Life Insurance at double your base salary, access to group legal services, identify theft protection through LifeLock services, etc. 
      • A generously paid parental leave policy that enables 16 weeks of leave, regardless of gender, at 100% pay. 
      • Supporting employees pursuing adoption or surrogacy, Isobar will reimburse up to $14,440 in eligible adoption expenses and $25,000 in eligible surrogacy expenses.  
      • 401K + company matching: 50% of every dollar you contribute, up to the first 6% you contribute; you are 33% vested after each year of service, becoming fully vested after three years with the company. 

      The anticipated salary range for this position is $145,000-$165,000. Salary is based on a range of factors that include relevant experience, knowledge, skills, and other job-related qualifications. For more information regarding dentsu benefits, please visit: dentsubenefitsplus.com

      #LI-YC1

      Qualifications

      Apply for this job

      +30d

      Jr Software Engineer

      agileDesignapi.netmysqltypescriptangularjavascript

      DealerOn, Inc. is hiring a Remote Jr Software Engineer

      Jr Software Engineer - DealerOn, Inc. - Career Page

      See more jobs at DealerOn, Inc.

      Apply for this job

      +30d

      AEM Tech Lead w/ Angular (contract)

      agileDesignjqueryscrumjavac++cssangularjavascript

      Blue Acorn iCi is hiring a Remote AEM Tech Lead w/ Angular (contract)

      AEM Tech Lead w/ Angular (contract) - Blue Acorn iCi - Career PageSee more jobs at Blue Acorn iCi

      Apply for this job