Front end software engineer Remote Jobs

95 Results

+30d

React Native Developer

iCoreKazhakkoottam, India, Remote
html5iosgitandroidcss

iCore is hiring a Remote React Native Developer

Job Description

  • Thorough understanding of React Native and its core Principles
  • Hands on experience on React Native Framework
  • Good Knowledge of HTML5, CSS
  • Familiarity with code versioning tools (Such as Git, SVN or Mercurial)
  • Familiarity with RESTful APIs

Job Location : Trivandrum, Cochin
Immediate joiners preferred

Qualifications

 

  • 2+ year(s) of experience with React Native. 

  • Experience integrating and implementing APIs, understanding of REST APIs, middle wares and offline storage. 

  • Experience with Git for source code management. 

  • Familiar with native build tools, like XCode, Gradle. 

  • Understanding of the Android & iOS ecosystem, their guidelines, configuration and building processes.

See more jobs at iCore

Apply for this job

+30d

Frontend Developers

iCoreKazhakkoottam, India, Remote
Designcssjavascriptredux

iCore is hiring a Remote Frontend Developers

Job Description

Responsibilities


 Determining the structure and design of web pages.
 Ensuring user experience determines design choices.
 Developing features to enhance the user experience.
 Striking a balance between functional and aesthetic design.
 Ensuring web design is optimized for smartphones.
 Building reusable code for future use.
 Utilizing a variety of markup languages to write web pages.
 Maintaining brand consistency throughout design.
 Identifying web-based user interactions.
 Developing and implementing highly-responsive user interface components using React concepts.
 Writing application interface codes using JavaScript following React.js workflows.
 Troubleshooting interface software and debugging application codes.
 Developing and implementing front-end architecture to support user interface concepts.
 Monitoring and improving front-end performance.
 Documenting application changes and developing updates.
 

Qualifications

Qualifications

 Experience: 3 to 6 Years
 Bachelor’s degree in Computer Science, Information Technology, or a similar field.
 Previous experience working as a React.js Developer.
 In-depth knowledge of JavaScript, CSS, HTML and jQuery.
 Knowledge of REACT tools including React.js, Webpack, Polymer, Redux, and Flux.
 Experience with user interface design.
 Knowledge of performance testing frameworks including Mocha and Jest.
 Experience with browser-based debugging and performance testing software.
 Excellent troubleshooting skills.
 Good problem solving skills.
 Excellent verbal communication skills.
 Good interpersonal skills.

See more jobs at iCore

Apply for this job

+30d

Frontend Developer (Shopify Agency)

Tako AgencyRocklin, CA, Remote
html5git

Tako Agency is hiring a Remote Frontend Developer (Shopify Agency)

Job Description

  • Multi-tasker and excellent problem solver
  • Great attention to detail and organized
  • Positive, upbeat attitude
  • Fast learner with a drive to continually learn new things
  • Excellent written and spoken English
  • Able to work a minimum of 30 hours/week, in either EST or PST timezones.

Qualifications

  • Excellent knowledge of modern cross-browser HTML5+, ES6+ and CSS3+ (SCSS)
  • Experience building high-quality, responsive layouts and with smooth interactions, transitions and animations
  • Ability to apply best practice modular web development
  • Fluency with version control and Git flows
  • Fluency in interpreting and working with third-party APIs
  • Awareness of the most established libraries, their ecosystems and how to choose between them

See more jobs at Tako Agency

Apply for this job

+30d

Frontend Developer

Go With FlowLeça da Palmeira, Portugal, Remote
postgresoracleDesignhtml5qajavacssangularjavascript

Go With Flow is hiring a Remote Frontend Developer

Job Description

As a Full Stack Developer, you will perform software development in all phases of the product lifecycle as part of a high-performing and multi-disciplinary team. You will play in a team of experts willing to fulfilling our vision, by developing the best code and setting exceptional standards.

 

You will…

  • Implement business requirements using object-oriented design and development strategies and patterns
  • Participate in the design process, programming, and testing of new features
  • Code and implement design specifications using Java (Quarkus), Javascript, CSS, Angular and related technologies.
  • Work closely with the product owner, other developers and QA engineers to shape the product.
  • Ensure our solutions are tested, extensible, maintainable, secure and perform well.
  • Write clear documentation of created/modified functionality.
  • Maintain code versioning using Gitlab

Qualifications

  • Consolidated experience in Java development
  • Consolidated experience in development with JavaScript, HTML5, CSS3, Angular
  • Domain of REST communication protocols
  • Good knowledge of design patterns.
  • We value experience in Responsive Design, Reactive Programming or Unit Testing
  • Nice-to-have: knowledge of technologies such as Apache Flink, Vert.x, PostGres, Oracle DB, Apache Kafka
  • Good knowledge of English
  • Strong communication, interpersonal and problem-solving skills
  • Ability to multi-task effectively in a fast-paced environment
  • High level of enthusiasm and desire to learn. Continuous improvement mindset

See more jobs at Go With Flow

Apply for this job

+30d

Front-End Developer Intern

RoyaltyBusayoMiami, FL, Remote
wordpressDesign

RoyaltyBusayo is hiring a Remote Front-End Developer Intern

Job Description

We are looking for an intern to:

  • Wireframe user experience
  • Help design front-end of web applications
  • Implement websites in CMS including WordPress and other front-end frameworks
  • This position is available in either part- or fulltime.
  • Can start immediately

This internship position is unpaid.

Qualifications

See more jobs at RoyaltyBusayo

Apply for this job

+30d

Frontend Developer (WPF/XAML)

RealDefensePasadena, CA, Remote
Designqac++.netbackendfrontendNode.js

RealDefense is hiring a Remote Frontend Developer (WPF/XAML)

Job Description

iolo / RealDefense is looking for a Frontend Developer to join our team.  RealDefense products, such as iolo's System Mechanic, have been around for 20+ years and are thriving in the new work at home culture. We are a consumer security company focused on providing solutions to the fast-growing work at home economy.  Come join our team and develop products that help everyday consumers.

Responsibilities:

  • Plan, design and develop high quality front end .NET desktop applications
  • Implement solutions using latest features of C# and WPF
  • Propose and deliver scalability and performance improvements to our GUIs
  • Work with other developers, QA and product managers in solving new and existing technical issues
  • Participate in Design and Code Reviews
  • Maintain ownership of the projects assigned
  • Meet project deadlines

Qualifications

Required Skills:

  • Expertise in Windows Desktop application front-end design and development
  • 1+ years experience developing Windows Desktop applications with XAML and WPF
  • Strong experience in all aspects of the software lifecycle including design and testing
  • Experience with the Blend XAML design tool
  • Familiar with .Net Core and .Net Framework class libraries
  • Experience working with web service SDKs and with HTTP client libraries
  • Very good oral and written communication skills

Preferred Skills:

  • Backend C# experience
  • Familiar with Node.js and associated backend technologies
  • Familiar with 3D rendering engines and libraries
  • Experience with Win10 Network, Startup, Processes and Services controls
  • Understanding of IIS/Webservice

Education:

Bachelor’s Degree in Engineering, or related technical field (or equivalent technical experience).

See more jobs at RealDefense

Apply for this job

+30d

Frontend Developer - Medior, Senior, Lead (m/f/d) - Zagreb (HR) or remote

ABOUT YOU GmbHZagreb, Croatia, Remote
UXqatypescriptlinuxAWSjavascriptfrontend

ABOUT YOU GmbH is hiring a Remote Frontend Developer - Medior, Senior, Lead (m/f/d) - Zagreb (HR) or remote

Job Description

We are currently looking for skilled & passionate Frontend Developers (m/f/d) across Medior, Senior and Lead levels to become part of one of our Tech teams, either working onsite in Hamburgremotely in the EU or in our Tech Hub in Zagreb, Croatia (planned to open in Spring 2022).

As ABOUT YOU is rapidly growing, we plan to open several Tech Hubs across Europe in Spring 2022 to attract and keep the best Tech talents in the region. All Tech Teams are driven by the dedication to deliver high-scalable applications shaped by a lean and intuitive user interface that ensures the best possible user experience. Your work will impact the future of how eCommerce is experienced by millions of customers.

Jump to the next career step and unlock the future potential of frontend development by constantly challenging your tech know-how with us!

 

What you will do

  • Build high traffic user interfaces with JavaScript and Vue.js
  • Work on the implementation of high-leverage features to optimize UX and conversion rates
  • Cooperate with skilled developers, managers, QA’s, and designers to ship new components and features
  • Draft architectural decisions together with the Tech Lead and explore new technologies
  • Have a direct impact on team processes by regular retrospectives
  • Exchange your knowledge with other developers and be part of our ABOUT YOU TECH community
  • As a Lead Frontend Developer
    • Lead a world-class team of engineers and collaborate with the product manager, QA’s, and with designers to ship new components and features
    • Build complex & high scalable frontend application in close cooperation with the Tech Lead and the Product Lead

Who you are

  • Very good & MVP-focused coding skills in JavaScript of minimum 3 years
  • Practical & recent experience with JS Frameworks like Vue.js
  • Comfortable working with TypeScript or ES6
  • Good background in building complex customer-facing products coming along with excellent analytical and problem-solving skills
  • Passionate about writing well-structured, efficient and maintainable code, actively keeping the quality of the code base in check
  • Used to work in an English-speaking environment
  • As a Lead Frontend Dev
    • 5+ years of experience in developing high-scalable and frictionless frontend applications 

Benefits

  • Grow together with one of the fastest-growing eCommerce companies in Europe
  • Flexible working times
  • 40% discount on our online shop
  • Language courses (German & English)
  • Free choice of hardware and operating system (Mac, Windows, Linux) also for private usage
  • State-of-the-art tech stack running on AWS
  • International working environment and English as company language

 

YOU ARE THE CORE OF ABOUT YOU. 
We take responsibility for creating an inclusive and exceptional environment where all genders, nationalities and ethnicities feel welcomed and accepted exactly as they are. We believe that a diverse workforce essentially contributes to the ABOUT YOU culture. In order to maintain talent and diversity, we emphasize the care for physical health, mental health and overall well-being. Our values and work ethics essentially contribute to our brand mission: empower acceptance and shape an inclusive, fair and circular fashion culture.
 

We are looking forward to receiving your application – preferably via our online application portal! Thus, we can ensure a faster process and for you it is very easy to upload your application documents.

Qualifications

See more jobs at ABOUT YOU GmbH

Apply for this job

+30d

Mid-Senior Front-End Developer (React)

IESF AGL'viv, Ukraine, Remote
4 years of experienceagileDesignscrumtypescriptjavascriptfrontend

IESF AG is hiring a Remote Mid-Senior Front-End Developer (React)

Job Description

The Role:
You are going to be responsible for the design and implementation of the Micro frontends architecture, bringing the responsiveness, efficiency, scalability, robustness and security of the system up to the next level.
Main Tasks:    
● Building of the new features;
● Developing and testing new user-facing features;
● Write highly scalable, reusable, and testable code;
● Optimize applications for maximum speed and performance;
● Collaborate with other team members;
● Maintain a pulse on emerging technologies and discover hidden opportunities in the environment;
● Participate in software quality assurance activities: write automated tests, participate in code review.
 

Qualifications

Your Profile:
•    Strong JavaScript knowledge with at least 4 years of experience; 
•    Experience with React; 
•    Familiarity with TypeScript; 
•    Will be a plus if you are familiar with Micro Frontend Architecture and Back-end part as well; 
•    Ability to integrate best practices and oversee technical solutions; 
•    Deep understanding of development principles and paradigms, architectural concepts, patterns, and approaches; 
•    Passion for agile development methodologies (Scrum, Kanban Lean) and engineering practices (continuous integration, continuous delivery, test-driven development); 
•    English level — Upper-Intermediate 

Personal Characteristics:
•    Strongly motivated and sets demanding standards for personal excellence; 
•    Autonomous self-starter and highly driven, able to lead large teams and initiatives with limited oversight; 
•    Effective collaborator with other team members; 
•    Independent thinker, inquisitive, eager to improve and learn; 
•    Confident being part of a small team that is building a business; 
•    You communicate rapidly, openly, inclusively and efficiently;
•    Structured thought process and clear communication.
 

See more jobs at IESF AG

Apply for this job

+30d

Sr. REACT Developer

SeamgenSan Diego, CA, Remote
figmaDesignuihtml5apijava.netcssjavascriptreduxreactjsbackend

Seamgen is hiring a Remote Sr. REACT Developer

Job Description

We are working on redeveloping the property marketing and leasing experience for one of North America's leading property management software platforms. From the ground up, the team is implementing a fully integrated platform that delivers a fresh, frictionless and intelligent experience for renters and property management companies, streamlining processes and improving business operations and communications.

Seamgen is seeking an experienced Front-End Developer that has the ability to transform beautiful UI designs into working applications. The ideal candidate will have experience with HTML5, JavaScript, REACT, and Bootstrap CSS, RESTful services, and one of NodeJS, .NET, or Java backend technologies.

Qualifications

Responsibilities

  • Ability to translate Wireframes and high fidelity design (Figma) into functional web apps

  • HTML5, CSS

  • ReactJS, Redux

  • Next.JS experience is a plus

  • Binding of UI elements to JavaScript object models, and using REST API's

  • Styled Components

  • Work in a cross-functional team to deliver a complete user experience

  • Write test, partake in code reviews, ensure quality code

  • Be responsive to change requests and feature requests

  • Write code that is cross-platform and cross-device compatible

  • Ability to wear many hats and learn new technologies quickly

See more jobs at Seamgen

Apply for this job

+30d

Front-End Developer

SeamgenSan Diego, CA, Remote
sketchDesignPhotoshopjquerymobileuihtml5cssangularjavascript

Seamgen is hiring a Remote Front-End Developer

Job Description

Responsibilities

  • Ability to translate Wireframes and PSD Designs into functional web apps using HTML5, CSS and JavaScript

  • Binding of UI elements to JavaScript object models

  • Work in a cross-functional team to deliver a complete user experience

  • Test and debug to ensure flawless functionality and performance of your design

  • Be responsive to change requests and feature requests

  • Write code that is cross-platform and cross-device compatible

  • Ability to wear many hats and learn new technologies quickly

Qualifications

Experience

  • 2-3 years minimum in creating complex HTML based solutions

  • Detail oriented experience as a Web Developer creating jQuery based solutions

  • Strong visual and interaction design skills

  • Ability to work both independently and in collaborative teams to communicate design and build ideas effectively

Requirements

  • Fluent knowledge of latest HTML/CSS standards and best practices

  • Working knowledge of JavaScript/jQuery

  • Solid Understanding of HubSpot 

  • Experience migrating Angular 1.x to Angular 2+

  • Interfacing with hospital patient intake system through an HL7 parser

  • Some experience with Photoshop or Sketch is a plus (creating sprites, optimizing, cutting or adjusting images)

  • Working knowledge of front end optimization and performance techniques

  • Knowing how to how to build a website using CRMs

  • Cross-browser development and troubleshooting

  • Experience building Responsive websites for web, tablet and mobile devices

  • Eye for details is crucial

  • Able to handle multiple projects and competing deadlines

  • Good understanding of overall web design including basic usability, accessibility, industry standards, architecture, and navigation

  • Portfolio of work required. Include examples of all areas of interaction design (user flows, wireframes, final graphical display)

See more jobs at Seamgen

Apply for this job

+30d

Staff Frontend Engineer

EgnyteRemote, India
Designhtml5UXqareduxbackendfrontend

Egnyte is hiring a Remote Staff Frontend Engineer

Description

Title: Staff Frontend Engineer

Location: India, Remote

 

EGNYTE YOUR CAREER. SPARK YOUR PASSION.

Egnyte is a place where we spark opportunities for amazing people. We believe that every role has meaning, and every Egnyter should be respected. With over 22,000 customers worldwide and growing, you can make an impact by protecting their valuable data. When joining Egnyte, you’re not just landing a new career, you become part of a team of Egnyters that are doers, thinkers, and collaborators who embrace and live by our values:

       Invested Relationships

       Fiscal Prudence

       Candid Conversations

 

ABOUT EGNYTE

Egnyte is the secure multi-cloud platform for content security and governance that enables organizations to better protect and collaborate on their most valuable content. Established in 2008, Egnyte has democratized cloud content security for more than 22,000 organizations, helping customers improve data security, maintain compliance, prevent and detect ransomware threats, and boost employee productivity on any app, any cloud, anywhere. For more information, visit www.egnyte.com

 

Egnyte is seeking talented engineers to join our team in Mumbai or to work remotely elsewhere in India. If you’d like to contribute your skills to the development of a global product with an impressive client base, please reach out!

Egnyte is a product-focused company based in Silicon Valley in California, not a software outsourcing business. We build and maintain our flagship software used by companies like Red Bull and Yamaha. We help businesses navigate the complex world of content and data management. Egnyte provides customers with secure access to 100% of their business files from any device, regardless of where those files physically reside. More than 16,000 customers trust Egnyte to enhance employee productivity, automate data management, and reduce file-sharing cost and complexity.

Your Qualifications

Experience leading team of engineers

Hands-on experience designing and developing highly scalable applications from both functional and performance perspective

Expert knowledge of ES6+, HTML5, CSS3

Experience with React ecosystem (our stack is based on React, Redux, Webpack)

Practical experience with TDD

Understanding of cross-browser compatibility issues

Adaptability in a dynamic environment

Practical experience with unit testing and end-to-end automation

What You’ll Do

Developing system components throughout the whole product lifecycle. Your task will be to build user interfaces that are usable and informative. In order to do that, you’ll need to combine and process data from different parts of the system. Building a scalable and maintainable product used by over 350 thousand users every day

Influencing the development strategy and technologies of a global product deployed on hundreds of servers around the world

Supporting other team members to help them fulfill their potential

Leading and owning projects end to end, from design to deployment

Learn, collaborate, and teach other Frontend Engineers.

Lead large-scale projects exerting significant influence on long term vision and goals for your team

Collaborating with other frontend developers to design, architect, implement, and build a frontend project

Being part of a professional team collaborating with QA and backend developers

Cooperating closely with UX designers and product owners to bring state-of-the-art frontend experience of a product.

Coming up with your own ideas for product enhancement and productivity boosts

 

BENEFITS:

Competitive salaries & Stock Options

Medical insurance and healthcare benefits for you and your family

Fully paid premiums for life insurance

Mental wellness platform subscription

Gym reimbursement

 

COMMITMENT TO DIVERSITY, EQUITY, AND INCLUSION:

At Egnyte, we celebrate our differences and thrive on our diversity for our employees, our products, our customers, our investors, and our communities. Egnyters are encouraged to bring their whole selves to work and to appreciate the many differences that collectively make Egnyte a higher-performing company and a great place to be.

 

See more jobs at Egnyte

Apply for this job

+30d

Senior Software Engineer, Frontend

AtticusLos Angeles, CA or Remote
scalaDesigngraphqluiUXgitrubyjavac++dockercsskubernetesjenkinspythonAWSfrontend

Atticus is hiring a Remote Senior Software Engineer, Frontend

About Us

At any given time, 16 million Americans are experiencing a crisis that requires urgent help from our legal system or government. The right assistance could transform their lives. But today, most never get it. 

Atticus makes it easy for any person in crisis to get the life-changing aid they deserve. In just three years, we’ve become the leading platform connecting people with disabilities to government benefits. We also help victims of accidents, misconduct, and violence get compensation from insurance. So far, we’ve gotten thousands of people access to over $2B in life-changing aid, and we’re just getting started.

We've helped more than 20,000 people in need (see our 6,000+ five-star reviews) and raised more than $50 million from top VC firms like Forerunner, GV (Google Ventures), and True Ventures. (We just closed our Series B round in May 2023, so we're well-funded for the foreseeable future.) We're small but moving fast — our team grew from 32 to 60 last year and we expect to double in size again in 2023.

The Job

Atticus works in an industry dominated by outdated technology that is ripe for fresh thinking: our core competitors rely on massive call centers to screen clients, antiquated CRMs to track and manage cases, and paper checks to get paid (provided they’re sent to the right address). 

Conversely, as a VC-backed tech company our product & engineering department powers everything we do: from creating an engaging online experience for people in crisis to providing tools for our network lawyers as they serve our clients, Atticus relies on technology to fulfill our mission.

We’re looking for Software Engineers to join our team. You’ll work on the front-end, and will partner with every department at Atticus as we continue to grow our platform to help people in need find trusted legal support.  

What You'll Do:

  • Design, build and operate Atticus’ front-end applications written in React with a focus on performance, modularity, extensibility, and reliability.
  • Architect, design, write, review, and test code in a collaborative environment with other software engineers.
  • Work with product to evaluate and refine product details and acceptance criteria
  • Evaluate new front-end technologies and methodologies with an eye toward scalability and performance.
  • Leverage your peers as multipliers for your skills to create excellent products and services.

The role is a rare opportunity to join a fast-growing Series B startup that doubles as a B-corp social enterprise. Every project you take on will help clients in need get the help they deserve, and you’ll shape our company culture as we scale. We’re looking for engineers who are excited about our mission and the challenges it entails.

Who You Are:

  • You write idiomatic JavaScript/Node.js; Golang, Java, Python, Scala, or Ruby is helpful.
  • You have experience and love for building performant React applications
  • You speak CSS and HTML fluently and know how to build around browser limitations
  • You enjoy working with UI and UX experts to build compelling user experiences
  • You enjoy helping your teammates grow their front-end skillset
  • You use a modern version-control system for your source code repository (Git, Mercurial, GitHub, BitBucket).
  • You lint all your code or know you should.
  • You know what parts of your code require tests and you write those tests.
  • You use objective judgment in leveraging the right frameworks and technologies.
  • You are versed in cloud computing systems (GCP, AWS, etc.) and SAAS concepts.
  • You leverage continuous integration systems to their full extent (CircleCI, Bamboo, Jenkins, TravisCI).
  • You plan for, build, evolve and scrutinize monitoring and alerting for your production systems.
  • You are willing and able to deploy, troubleshoot, and maintain your systems in production and staging environments.

Extra Credit:

  • You like working with Google Cloud Platform, Kubernetes, Docker, Git, Golang, Java
  • You are well versed in working with GraphQL, GraphQL Federation, REST APIs and supporting network protocols
  • You can build a great Webpack configuration

We are strongly committed to building a diverse team. If you’re from a background that’s underrepresented in tech, we’d love to meet you!

Salary and Benefits

This is a rare opportunity to join a startup that has strong traction (substantial funding, well-respected backers, tremendous growth, and many happy customers) but is still small enough that you can have a huge impact and play a role in shaping our culture.

We’re a certified B Corporation tackling a critical social problem. Our mission to help people in need drives everything we do, and your work here will touch many lives.

We offer competitive pay — including equity — and generous benefits:

  • Medical and dental insurance with 100% of employee premiums covered
  • 15 vacation days & ~19 paid holidays each year (including two weeks at end-of-year)
  • Free membership to OneMedical
  • $1,000 reimbursable stipend for education and training outside of work
  • Student loan repayment assistance, 401(k), and optional HSA
  • Free snacks, drinks, weekly lunches, and regular team dinners/events/retreats
  • Humble, thoughtful, smart, fun colleagues 

We anticipate the base salary band for this role will be between $170,000 to $220,000 in addition to equity and benefits. The salary at offer will be determined by a number of factors such as candidate’s experience, knowledge, skills and abilities, as well as internal equity among our team.

Location & Covid

Today, about half our team are in Los Angeles or Phoenix (where we have offices) and half are fully remote and spread across the U.S. There are two options for this job:

  1. Live in Los Angeles, work a few days a week (or more) out of our beautiful office in the Arts District.
  2. Live wherever, work remotely, and travel to LA (on the company dime) as needed to be with your colleagues —somewhere between monthly and quarterly.

In short: You can do this job well remotely, and we’re committed to empowering everyone with flexibility. But we care a lot about building a great culture and we think some interactions need to happen in person, so we put a lot of thought into retreats, offsites, and other ways to gather. 

As for Covid: When the pandemic started, we immediately shifted to fully remote to protect our team and shuttered our office. Today, everyone on the team is vaccinated, and many come in often (though we don’t require it). Going forward, you can expect that vaccinations will be required for all employees (unless medically unable) and that if a variant emerges that makes in-person work unsafe for vaccinated people, we’ll close our office, cease any travel, and do whatever it takes to protect and support our team.

See more jobs at Atticus

Apply for this job

+30d

Software Engineer (Frontend)

JW PlayerMexico - Remote
Designhtml5javadockerpostgresqlmysqltypescriptkubernetesangularpythonAWSjavascriptfrontend

JW Player is hiring a Remote Software Engineer (Frontend)

About JW Player:

JWP is the game-changing video software and data insights platform that's revolutionizing the Digital Video Economy. With our cutting-edge technology, we give our customers unparalleled independence and control over their digital video content. We began over a decade ago as an open-source video player, but today, JWP is the driving force behind digital video for hundreds of thousands of businesses worldwide. And with over 1 billion viewers tuning in every month across 2.7 billion unique devices, there's no limit to what we can achieve. We're on the lookout for passionate and innovative candidates who are ready to join us on this journey of transforming the world of digital video.

The Growth Engineering Team:

The Growth Engineering team is a full-stack product development team supporting the biggest media-driven publishers in the world. The team builds front-end components and scalable back-end services that integrate with industry leading advertising and data partners. The success of the team is measured by our customers' monetization of their video strategies.

The Opportunity:

You will join a collaborative team building front-end projects that directly add user value to publishers and end-users at scale. As a software engineer, you will have opportunities to independently drive features with experienced engineering mentorship. You will work closely with junior and senior engineers, contributing to the entire development life cycle. Your technical skills and creative problem-solving will be instrumental in ensuring our software meets performance benchmarks and scales efficiently.

As a Frontend Engineer, you will:

  • Craft code adhering to internal standards for maintainable and high-scale web development with minimal guidance and support from other team members
  • Working in a cross-functional team, collaborating with back-end, design, and product management to deliver exceptional customer experiences. 
  • Working with a range of front-end technologies, including React, TypeScript, SCSS, build-tools, and more.
  • Proven ability to articulate complex issues in technology, architecture, or organizational structures while offering detailed, incremental solutions.
  • Participate in planning activities, code reviews, and providing feedback
  • Stay up-to-date with industry trends, best practices, and emerging technologies, and propose innovative solutions to improve product functionality and performance.

Requirements for the role:

  • 3+ years of full-stack software development (80% front-end 20% back-end)
  • Proven track record of delivering high-quality, scalable, and performant web applications using modern front-end technologies such as React, Angular, or Vue.js.
  • Strong expertise in HTML5, CSS3, and JavaScript is a must, with a deep understanding of front-end frameworks, libraries, and tooling. Experience with TypeScript is highly desirable.
  • Solid understanding of UX/UI principles and the ability to translate design mockups into interactive, responsive user interfaces. Experience with design systems and component libraries is a plus.
  • Experience working closely with back-end engineering projects in at least one back-end language (e.g. Python, Java, Go etc.) and database systems (PostgreSQL, MySQL, Mongo, etc.).
  • Demonstrated experience in optimizing front-end performance and implementing best practices for web accessibility and SEO. Proficiency in debugging and performance profiling tools is required.
  • Excellent collaboration and communication skills are essential, as you will work closely with cross-functional teams, including designers, back-end engineers, and product managers, to deliver outstanding user experiences. Leadership experience and the ability to mentor junior team members is highly valued.

Bonus points:

  • Experience directly or indirectly working with advertising technology
  • Experience with Docker and Kubernetes
  • Experience with design systems and component libraries
  • Familiarity with cloud platforms (AWS preferred) and deploying applications in a cloud environment.
  • Knowledge of video technologies and standards (e.g., HLS, DASH) is a plus.

We are an equal opportunity employer and value diversity at our company. We do not discriminate on the basis of race, religion, color, national origin, gender, sexual orientation, age, marital status, veteran status, or disability status.

See more jobs at JW Player

Apply for this job

+30d

Senior Software Engineer (Frontend)

ClassyRemote, US
agileDesignmongodbgraphqlscrumUXc++dockerelasticsearchmysqltypescriptlinuxAWSjavascriptfrontendNode.jsPHP

Classy is hiring a Remote Senior Software Engineer (Frontend)

Classy, an affiliate of GoFundMe, is a Public Benefit Corporation and giving platform that enables nonprofits to connect supporters with the causes they care about. Classy's platform provides powerful and intuitive fundraising tools to convert and retain donors. Since 2011, Classy has helped nonprofits mobilize and empower the world for good by helping them raise over $6 billion. Classy also hosts the Collaborative conference and the Classy Awards to spotlight the innovative work nonprofits are implementing around the globe. For more information, visitwww.classy.org.

About the role:

Classy's Product Technology team is hiring a Senior Front-End Software Engineer to build and extend our visualization tools, component library, and new experiences for the next phase of our business. The ideal candidate is highly skilled in front end web development using React and TypeScript, as well as building and maintaining a component library. We want to talk to you if you can see beyond the {brackets} and love transforming designs and mockups into highly-scalable, fault-tolerant, and seamless user experiences. 

What you’ll do:

  • Analyze, design, and develop software that delivers clean, maintainable code within a large, complex, and established code base.
  • Contribute to the Classy component library to be consumed throughout the organization for new and existing user experiences.
  • Learn and grow your skills by working collaboratively with experienced and engaged developers to design new features and re-architect existing ones.
  • Within an Agile environment, work as part of a Scrum team and develop web-based software solutions.
  • Mentor engineers to become proficient developers using best software development practices and processes.

What you bring (Required):

  • Bachelor’s Degree in Computer Science or a related field, or equivalent work experience.
  • 4+ years of professional software development experience with relevant web development technologies
  • Passion for UX and design, specifically building and maintaining a component library
  • Excellent understanding of distributed software architecture with experience debugging distributed systems with high data loads.
  • High-level proficiency with Javascript ES6, TypeScript & React.
  • Ability to understand product requirements and translate them into technical subtasks.
  • Experience with Scrum/Agile development methodologies.
  • Deep experience with code versioning tools (GIT/Bitbucket).
  • A deep sense of quality, and sharp engineering skills with strong computer science fundamentals.
  • Experience working with remote and offshore teams

What would be awesome to have (Preferred):

  • Experience building PCI compliant systems
  • Experience with simultaneously managing multiple web application frameworks and/or migrating from one framework to another. 
  • Experience working with MySQL, MongoDB, Node.js, PHP, Linux, & Next.js
  • Experience working with Microservice architecture and Micro Frontends
  • Familiarity with GraphQL, Elasticsearch, Docker, AWS (EC2, ECS, Lambda, SNS).
  • Familiarity with Storybook 

Why you’ll love it here: 

  • Market competitive pay
  • Rich healthcare benefits, including employer paid premiums for medical/dental/vision (100% for employee only plans and 85% for employee + dependent plans) and employer HSA contributions. 
  • 401(k) retirement plan with company matching
  • Hybrid workplace with fully remote flexibility for many roles
  • Monetary support for new hire setup, hybrid work & wellbeing, family planning, and commuting expenses
  • A variety of mental and wellness programs to support employees   
  • Generous paid parental leave and family planning stipend
  • Supportive time off policies including vacation, sick/mental health days, volunteer days, company holidays, and a floating holiday
  • Learning & development and recognition programs
  • Gives Back Program where employees can nominate a fundraiser every month for a donation from the company
  • Inclusion, diversity, equity, and belonging are vital to our priorities and we continue to evolve our strategy to ensure DEI is embedded in all processes and programs at GoFundMe. Our Diversity, Equity, and Inclusion team is always finding new ways for our company to uphold and represent the experiences of all of the people in our organization.
  • Employee resource groups
  • Your work has a real purpose and will help change lives on a global scale.
  • You’ll be a part of a fun, supportive team that works hard and celebrates accomplishments together. 
  • We live by our core values: impatient to be great, find a way, earn trust every day, fueled by purpose
  • We are a certified Great Place to Work, are growing fast and have incredible opportunities ahead!
  • Our commitment to Sustainability.Classy exists to create a sustainable world for all. 

Dedication to Diversity 

Classy is working toward building a more diverse and inclusive environment that is representative of individuals of all backgrounds, experiences, and lifestyles, allowing all employees to feel comfortable being their true, authentic selves in a space that enables productivity and meaningful work.

The total annual salary for this full-time position is $130,000- $175,000 + equity + benefits.  As this is a remote position, the salary range was determined by role, level, and possible location across the US. Individual pay is determined by work location and additional factors including job-related skills, experience, and relevant education or training. 

Your recruiter can share more about the specific salary range based on your location during the hiring process. 

If you require a reasonable accommodation to complete a job application or a job interview or to otherwise participate in the hiring process, please contact us at accommodationrequests@gofundme.com



See more jobs at Classy

Apply for this job

AlphaSights is hiring a Remote Senior Frontend Engineer (Remote) - Portugal

Job Application for Senior Frontend Engineer (Remote) - Portugal at AlphaSights

See more jobs at AlphaSights

Apply for this job