javascript Remote Jobs

833 Results

16d

D1 Software Engineering Manager

CloudflareHybrid or Remote
Bachelor's degreepostgressqlc++javascript

Cloudflare is hiring a Remote D1 Software Engineering Manager

About Us

At Cloudflare, we are on a mission to help build a better Internet. Today the company runs one of the world’s largest networks that powers millions of websites and other Internet properties for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Job Location: Austin, TX

About the Department

Emerging Technologies & Incubation (ETI) is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

What you'll do

We announced Cloudflare Workers in 2017  — since then it’s played a key role in Cloudflare’s strategy for entering the developer platform market. Until the launch of Workers, as Cloudflare was ramping up its capabilities in the performance and security spaces, it became clear that developers needed more ways to control the edge than rules engines could support. Workers has allowed Cloudflare to add programmability to the edge such that developers could have access to writing logic on the edge in their preferred way — through code. Over the past few years, Workers has grown from a simple functions-as-a-service option into a fully blown full-stack platform. With any application, however, in addition to serverless compute, you need to be able to manage state. In 2022, Cloudflare released D1 — built on Durable Objects, D1 is Cloudflare’s first serverless database. 
In this role, you’ll be helping define and build the future of D1, making sure we’re focused on the highest priority projects to enable developers to build full stack applications. 

Examples of desirable skills, knowledge and experience

  • Experience with any of the following programming languages: JavaScript, C++, Web Assembly. Rust or Go
  • Experience with SQL databases (e.g. SQLite, Postgres)
  • Experience using best practices for operating software in a software-as-a-service environment
  • Experience planning and overseeing execution to meet commitments and deliver with predictability
  • Experience implementing tools, process, internal instrumentation, methodologies and resolving blockages
  • Comfortable hiring and leading a workstream aligned team with both fullstack and distributed systems skillsets

Bonus Points

  • Experience building software for developers either open source or business-to-business
  • Experience building distributed systems or databases

 

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

16d

AEM Technical Product Manager

Blend36Chicago, IL, Remote
agileBachelor's degree5 years of experiencejiraDesignscrumjavascript

Blend36 is hiring a Remote AEM Technical Product Manager

Job Description

The AEM Technical Product Manager at Blend plays a crucial role in the strategic development and operational execution of technology projects, specifically utilizing Adobe Experience Manager (AEM). This position requires a unique mix of technical skill, strategic planning, and team leadership to deliver digital solutions that align with our business goals and enhance customer experience. The Technical Product Manager will be instrumental in driving the evolution of our digital platforms, ensuring they meet and exceed the needs of our users and stakeholders.

What You Will Be Doing:

  • Strategy and Collaboration: Assess technology project costs and benefits, prioritize initiatives, and lead cross-functional teams to refine requirements and document specifications. Recommend and implement integration strategies.

  • Project Management and Execution: Manage the product backlog, coordinate solution development, and oversee project implementations to ensure quality and adherence to timelines.

  • Technical Design and Analysis: Lead technical design sessions, translate requirements into technical specifications, and propose improvements to business processes.

  • Agile Practices and Communication: Facilitate Agile methodologies, acting as a communication hub between technical teams and stakeholders to optimize the use of AEM and related technologies.

Qualifications

  • Bachelor's degree in Information Technology or a related field; Master's degree preferred.
  • 3-5 years of experience with Adobe Experience Manager.
  • Experience in front-end technologies (JavaScript, HTML) with a preference for full-stack capabilities.
  • Demonstrated success in digital project management and web application development.
  • Strong skills in project scoping, estimation, scheduling, and resource management.
  • Excellent critical thinking, communication, and relationship management abilities.
  • Agile methodology proficiency, with experience using tools like Jira and Asana.
  • Certified Scrum Master (CSM) or equivalent experience preferred.

See more jobs at Blend36

Apply for this job

16d

ThingWorx Senior Developer

TestYantra Software SolutionsUnited Kingdom Remote
agile5 years of experiencenosqlsqluiscrumapijavapostgresqljavascript

TestYantra Software Solutions is hiring a Remote ThingWorx Senior Developer

Primary Skills:

· At least 5 years of experience on ThingWorx Platform

· Strong programing background and expertise in JavaScript and Java

· Have experience in delivering IoT solution using ThingWorx Platform

· Experience on Thingworx extension development is added advantage

· Experience on Thingworx DPM and Thingworx FSU Apps (CWC, RTTPM, AMU) is added advantage

· Must have executed at least 3 medium/large implementations on ThingWorx

· Experience in writing ThingWorx services in JavaScript

· Industry standard UI creation using ThingWorx Mashups

· Experience with PTC Kepware

· Experience with DevOps is a plus

· Experience on working in scrum framework

· DBMS Skills: RDBMS (PostgreSQL, MSSQL and others) and NoSQL

· Basic understanding of SQL and API connections

· Functional understanding of JSON, REST APIs and read API documentation

· Understand business requirements and translate them into well engineered and integrated technical solutions

· Client focused to understand and appropriately respond to our client’s business needs

· Guide and mentor team members

· Versatility, flexibility, and proactivity when resolving technical issues and dealing with ambiguity

· Manufacturing experience is preferred

· Good in Communication Skills

Other Skills:

· Understanding of Agile methodologies

· Familiarity with architecture styles/APIs (REST, RPC)

· Guide and mentor team members

See more jobs at TestYantra Software Solutions

Apply for this job

16d

Sr. Magento UI Senior Developer (Remote, USA)

McFadyen DigitalVienna, VA, Remote
agilemagentoDesignjqueryuihtml5cssjavascriptfrontend

McFadyen Digital is hiring a Remote Sr. Magento UI Senior Developer (Remote, USA)

Job Description

Opportunity

Do you have a passion for technology and solving problems? Are you an innovative person? Are you self-directed, confident, and able to work without requiring a great deal of structure or supervision? Are you highly self-motivated and having a head full of ideas? If you answered yes to these questions, we want to talk to you!

McFadyen Digital is looking for a new A-player to join our team. We would love to share with you the amazing journey that is work for a great e-commerce company as McFadyen is. If you like to work with the overseas team, and big challenges do not scare you, let’s talk about this amazing opportunity.

Responsibilities

Top five Responsibilities
 

  1. Demonstrate proficiency in Magento , showcasing in-depth expertise in the Magento. framework, Frontend Architecture, Themes, Modules, Functionality, and Configuration.
  2. Create high-quality, organized, and reliable code that meets specific requirements in Magento, HTML, CSS, JavaScript, and Knockout with minimal guidance.
  3. Implement responsive web design to support multiple devices.
  4. Hands on experience in creating and extending Magento themes.
  5. Actively contribute ideas to improve the application's usability and overall quality.

Additional Responsibilities

  • Review business requirements and collaborate with team members.
  • Apply website performance concepts to projects.
  • Innovate and enhance capabilities through Proof of Concepts (PoCs).
  • Establish a library of reusable components for diverse projects.
  • Research new integration and plug-in capabilities.
  • Work in a small, fast-paced, team-oriented environment.
  • Assist in the implementation of UI best practices.
  • Adhere to code standards, conduct thorough code reviews, and ensure consistency.
  • Deliver consistent user interfaces across multiple platforms.
  • Provide production support for implemented changes.
  • Demonstrate a good understanding of SEO principles and web content accessibility guidelines.
  • Have a good understanding of version control like GIT.

Qualifications

Qualifications and Skills:

  • Experience in coding HTML5, CSS3, JavaScript, Knockout, RequireJS
  • Emphasis in hands-on coding in Knockout is a must.
  • Understand the Magento 2 UI Framework
  • Excellent troubleshooting and debugging skills
  • In-depth knowledge of Magento’s code structure, extension architecture, theming hierarchy, and fallback components
  • Experience in Less and Grunt Workflow
  • Experience in Customizing Magento jQuery Widgets
  • Experience working in Magento 2.0
  • Ability to work under minimum supervision and with self-organizing teams

Desired Characteristics in Candidates:

  • Effective communication skills for technical and non-technical audiences.
  • Analytical and proven problem-solving skills.
  • High emotional intelligence (EQ).
  • Embraces challenges.
  • Team-oriented mindset.

Basic Qualifications

  • Minimum 4-6 years of professional experience in Magento UI.
  • Demonstrated proficiency in designing and elevating design systems.
  • High standards for visual craft and UI design.
  • Effective written and verbal communication skills.
  • Proven leadership in designing end-to-end product experiences, from concept to launch.
  • Ability to thrive in a highly agile and rapidly iterative environment.

What we can offer you

  • A career with thought leaders who literally wrote the book on Marketplace Best Practices
  • A career in the fast-paced world of retail eCommerce, digital marketplaces and platform businesses
  • A career with first-movers who are deploying new business models and strategies worldwide
  • A career in a flat management structure without a rigid hierarchy and bureaucracy
  • A career in a culture that rewards creativity and innovation, risk-taking and teamwork

See more jobs at McFadyen Digital

Apply for this job

16d

Magento UI Technical Lead

McFadyen DigitalVienna, VA, Remote
agilemagentoDesignmobileuihtml5UXqamysqljavascriptPHP

McFadyen Digital is hiring a Remote Magento UI Technical Lead

Job Description

Do you have a passion for technology and solving problems? Are you an innovative person? Do you have the mindset to mentor team members on the Magento platform and new technologies/solutions? Are you self-directed, confident, and able to work without requiring a great deal of structure or supervision? Are you highly self-motivated and have a head full of ideas? If you answered yes to these questions, we want to talk to you!!   

McFadyen Digital is looking for a new A-player to join our team. We would love to share with you the amazing journey that is work for a great e-commerce company as McFadyen is. If you would like to work with the overseas team, Magento is your specialty and big challenges do not scare you, let us talk about this amazing opportunity.  

Responsibilities      

Top 5 responsibilities   

  1. Writing and maintaining the modules of Magento EE/Cloud. 

  1. Architect and propose Magento solutions as per client requirements.  

  1. Perform a technical analysis of requirements.  

  1. Train the subordinate team of developers.  

  1. Be actively involved in the pre-sales activities by demonstrating technical capabilities through POCs.   

Additional Responsibilities   

  • Review business requirements working with other team members.  

  • Produce a solid, detailed technical design.  

  • Write clean, modular, robust code to implement the desired requirements with little or no supervision.  

  • Work with the QA and Customer Support teams to triage and fix bugs with rapid turnaround.  

  • Contribute ideas for making the application better and easier to use.  

  • Create reusable components, which can be configured for different projects.  

  • Writing unit test cases and unit testing of the code written.  

  • Research on new integration and plug-in capabilities.  

 

Qualifications

Top 5 Qualifications   

  1. Strong understanding of the Magento System Architecture, Design, Theming, Functionality Enhancements, Configuration  

  2. Experience leading technical teams.  

  3. Strong PHP and Magento skills with an emphasis on Object Orientated Programming.  

  4. Strong experience on MYSQL DB.  

  5. Experience working on Agile methodologies.  

Additional Responsibilities   

  • Follow a user-centered design process, UI / UX integration experience.  

  • Should have the knowledge to customize Magento Theme.  

  • Experience in creating modules (payment, shipping, etc.)  

  • Experience in creating customizable plugins for Magento.  

  • Good understanding of Zend framework preferable.  

  • Full Stack skills are desirable.  

  • Good understanding of W3C compliant HTML and CSS.  

  • Good HTML5, CSS3, AJAX, JSON skills & solid programming background in PHP for implementing web technologies.  

  • Experience in creating responsive web applications using Bootstrap.  

  • Experience in hand-coding JavaScript (ES5/ES6) and jQuery.  

  • Conceptual and implementation knowledge of MVC framework.  

  • Knowledge and integration experience with server-side communication using Ajax and JSON.  

  • Experience developing front-end applications and solving Cross-browser, Cross-platform, cross-mobile UI issues.  

  • Understand implement SEO and Accessibility compliance to the developed applications.  

  • Willingness to mentor and lead design and development initiatives.  

  • Ability to guide the team in all technical perspectives.  

  • Understanding of build tools like web pack, grunt, gulp.  

  • Exposure to Mirakl or other marketplace platforms is a huge plus.  

  • Experience in PWA is a plus.  

What We Can Offer You:     

  • A career with thought leaders who literally wrote the book on Marketplace Best Practices.    

  • A career in the fast-paced world of retail eCommerce, digital marketplaces, and platform businesses.     

  • A career with first movers who are deploying new business models and strategies worldwide.    

  • A career in a flat management structure without a rigid hierarchy and bureaucracy.    

  • A career in a culture that rewards creativity and innovation, risk-taking and teamwork.   

See more jobs at McFadyen Digital

Apply for this job

16d

Front-end Technical Lead

McFadyen DigitalFlorianópolis, Brazil, Remote
agileB2BDesignjquerymobileuicssjavascriptfrontendNode.js

McFadyen Digital is hiring a Remote Front-end Technical Lead

Job Description

Are you a technology leader capable of conceptualizing, building, and implementing application architecture, as well as owning the efforts of application strategies and roadmap efforts?   

Are you passionate about software UI architecture and driven to deliver exceptional solutions?   

Can you help Fortune 500 retailers navigate the next generation of digital commerce, marketplace, and platform business strategies?   

Are you skilled in a variety of retail and distribution functional areas?   

As a Front-end Technical Lead, you will be responsible for ensuring the success of our retail and B2B customers by applying your engineering expertise and domain knowledge.  

Responsibilities   

Top 5 responsibilities   

  • Work closely with the onshore teams and clients while running and being responsible for multiple projects at the offshore development center.  
  • Create reusable and clean UI pattern framework that application developers can use to plug and play.  
  • Devise complex architectural front end functional elements.  
  • Team with our Application Developers to bridge the client's side with server-side code.   
  • Provide production support for all implemented changes.  

Additional Responsibilities  

  • Translate conceptual ideas into engaging visual presentations and design solutions.  
  • Adhere to code standards and ensure consistency.  
  • Work in a small, fast paced, team-oriented environment.  
  • Liaise closely with onsite counterparts in order to continue to drive the product forward.  
  • Handle customer expectations on challenging projects.  
  • Understand how Frontend changes can impact the overall User experience.  

Qualifications

Qualifications
Top 5 Qualifications   

  • Applied experience of UI development principles.   
  • Understand the complexities of Rich Internet Applications and device optimal solutions.   
  • Strong HTML, JavaScript, and CSS experience.   
  • Strong React and Node.js experience.  
  • Expert in interaction development. 

Other Qualifications    

  • Master’s or Equivalent Degree in CS/EE.  
  • Overall 8+ years of frontend development experience in client-side UI development.  
  • Experience in creating responsive web applications.   
  • High level understating of frameworks like jQuery, Backbone, Handlebars, and Angular.   
  • Conceptual and implementation knowledge of MVC framework.   
  • Knowledge and integration experience with server-side communication using Ajax and JSON.   
  • Experience developing sophisticated front-end applications and solving Cross-browser, Cross-platform, cross-mobile UI issues.   
  • Understand implement SEO and Accessibility compliances to the developed applications.   
  • Content Management Systems and Mobile interface experience is a plus.   
  • Good exposure to eCommerce is preferred and strong experience in agile methodology is a plus.   
  • Excellent written and oral communication in English and interpersonal skills.   
  • Passion for web visitor conversions. 

See more jobs at McFadyen Digital

Apply for this job

16d

Senior Brand Motion Designer

GeminiRemote (USA)
remote-firstfigmaDesignPhotoshopmobileuicssjavascript

Gemini is hiring a Remote Senior Brand Motion Designer

About the Company

Gemini is a global crypto and Web3 platform founded by Tyler Winklevoss and Cameron Winklevoss in 2014. Gemini offers a wide range of crypto products and services for individuals and institutions in over 70 countries.

Crypto is about giving you greater choice, independence, and opportunity. We are here to help you on your journey. We build crypto products that are simple, elegant, and secure. Whether you are an individual or an institution, we help you buy, sell, and store your bitcoin and cryptocurrency. 

At Gemini, our mission is to unlock the next era of financial, creative, and personal freedom.

In the United States, we have a flexible hybrid work policy for employees who live within 30 miles of our office headquartered in New York City and our office in Seattle. Employees within the New York and Seattle metropolitan areas are expected to work from the designated office twice a week, unless there is a job-specific requirement to be in the office every workday. Employees outside of these areas are considered part of our remote-first workforce. We believe our hybrid approach for those near our NYC and Seattle offices increases productivity through more in-person collaboration where possible.

The Department: Design

In Design, we think comfort zones are the enemy of creativity.  A dynamic team of designers, engineers, researchers, our team blends beauty with tech to create a world-class product interface for our exchange. We are inspired by design, fueled by data, and obsessed with the user, both retail and institution.

The Role: Senior Brand Designer

As Senior Brand Designer, you’ll form the cornerstone of content. You’ll join a dynamic team of innovative visual and experience designers as well as developers, working to bring our user experience to the next level. The Senior Brand Designer will liaise directly with our Marketing & Communications teams to create the most compelling and creative ad, social, and video content. Most importantly, you’ll be responsible for defining how the world views Gemini, evangelizing and educating users about the innovative industry.

This designer will be focused on marketing and brand design while collaborating across the product design team. This individual will support business goals related to brand building, and brand recognition. They will also contribute to building the Gemini brand and have the ability to creatively express the brand across a variety of mediums.

Responsibilities:

  • Work with the creative team in all stages of developing motion assets, from concept to development and final production
  • Create and revise design of still frames and storyboards
  • Work within the brand design team to develop our brand motion toolkit
  • Work with product design team to craft UI motion behaviors and animations that orient, guide, and add delight for customers
  • Utilize sound design to execute projects
  • Delivery multiple mediums of work, spanning from 2D title and super animation, 2D/3D  motion design/animation that may be output for TV Broadcast, HD Video, social channels (Facebook, Instagram, Vimeo, Youtube, Twitter, etc)
  • Address all necessary feedback and follow up with manager and our development team 
  • Participate constructively in inter-department and cross-service line communications
  • Execute design work to ensure final deliverables meet Gemini standards

Qualifications:

  • Minimum of 5 years experience in motion and creative coding
  • Is a master of Adobe Creative Suite (After Effects, Photoshop, Illustrator, etc), Cinema 4D, Figma, Lottie as well as emerging interactive design trends
  • Demonstrates an in-depth, understanding of layout, typography, hierarchy, motion and interaction design
  • Experience with animation for mobile app content
  • Understands file compression, viewing specifications, and delivery of all media formats and channels
  • Bonus: Experience as a creative coder and understanding of HTML, CSS, JavaScript
  • Collaborated with Creative Directors, Art Directors, and Copywriters to develop stories and create storyboards and design elements
  • Experience concepting unique ideas for video and motion graphic assignments and/or advertising campaigns.
  • High level of craft and attention to detail is required
  • Excellent time management with strong organizational, communication and conceptual thinking skills
  • Team player and self-starter with a hunger for collaboration across all disciplines of design, marketing, product and engineering
  • Ability to balance and prioritize multiple projects simultaneously in a fast-paced, ever-changing environment
  • Hard worker with a heavy dose of humility
  • A portfolio of relevant design work is required for consideration
It Pays to Work Here
 
The compensation & benefits package for this role includes:
  • Competitive starting salary
  • A discretionary annual bonus
  • Long-term incentive in the form of a new hire equity grant
  • Comprehensive health plans
  • 401K with company matching
  • Paid Parental Leave
  • Flexible time off

Salary Range: The base salary range for this role is between $95,000 - $119,000 in the State of New York, the State of California and the State of Washington. This range is not inclusive of our discretionary bonus or equity package. When determining a candidate’s compensation, we consider a number of factors including skillset, experience, job scope, and current market data.

At Gemini, we strive to build diverse teams that reflect the people we want to empower through our products, and we are committed to equal employment opportunity regardless of race, color, ancestry, religion, sex, national origin, sexual orientation, age, citizenship, marital status, disability, gender identity, or Veteran status. Equal Opportunity is the Law, and Gemini is proud to be an equal opportunity workplace. If you have a specific need that requires accommodation, please let a member of the People Team know.

#LI-GR1

Apply for this job

16d

Senior Staff Vulnerability Management Security Engineer

ServiceNowSan Diego, California, Remote
agilejavac++dockerkubernetespythonjavascript

ServiceNow is hiring a Remote Senior Staff Vulnerability Management Security Engineer

Job Description

About Digital Technology & The SSO  

We’re not yesterday’s IT department, we're Digital Technology. The world around us keeps changing and so do we. We’re redefining what it means to be IT with a mindset centered on transformation, experience, AI-driven automation, innovation, and growth.   

We’re all about delivering delightful, secure customer and employee experiences that accelerate ServiceNow’s journey to become the defining enterprise software company of the 21st century. And we love co-creating, using, and highlighting our own products to do it.   

Ultimately, we strive to make the world work better for our employees and customers when you work in ServiceNow Digital Technology, you work for them.   

The ServiceNow Security Organization (SSO) delivers world-class, innovative security solutions to reduce risk and protect the company and our customers. We enable our customers to migrate their most sensitive data and workloads to the cloud, accelerating our business so that we are the most trusted SaaS provider. We create an environment where our employees are proud to work and can make a positive impact  

  

Please Note: This position will include supporting our US Federal customers. 

This position requires passing a ServiceNow background screening, USFedPASS (US Federal Personnel Authorization Screening Standards). This includes a credit check, criminal/misdemeanor check and taking a drug test.  

Any employment is contingent upon passing the screening.  Due to Federal requirements, only US citizens, US naturalized citizens or US Permanent Residents, holding a green card, will be considered. 

 

What you get to do in this role: 

  • Assess security risk and impact of issues pertaining to ServiceNow 

  • System Scanning and Vulnerability Management 

  • Partner with stakeholders to provide triage and remediation recommendations 

  • Partner with compliance teams to ensure appropriate level of risk management 

Qualifications

 

To be successful in this role you have: 

  • US Citizenship is Required. Must be eligible for a Public Trust Position (PTP) to support US regulated environments. 

  • Extensive experience and proficiency with Python, C++, JavaScript, or Java  

  • Minimum of 10 years relevant experience, including Vulnerability Management for Corporate and/or Cloud Systems 

  • Extensive experience with Vulnerability Management Scanning Tools (e.g., Tenable, Qualys, Rapid7, Wiz, etc.) 

  • Understanding and experience with Federal, PCI Compliance and Security Frameworks 

  • Familiarity with Container Solutions (e.g., Docker, Kubernetes, etc.) 

  • Extensive experience with Infrastructure, Cloud, and Risk Assessment 

  • Fundamental understanding of Systems and Network Engineering 

  • Deep understanding of Network Communications OSI 

  • An analytical mind for problem solving, abstract thought, and defensive security tactics 

  • Strong interpersonal skills (written and oral communication) 

  • Experience with remote collaboration 

  • Ability to articulate complex issues to executives and customers 

  • Familiarity with ServiceNow Platform and Agile Methodologies 

  • Adaptable to evolving situations. 

  • Masters degree in Computer Science or equivalent experience 

#DTjobs  

#SecurityJobs 

 

For positions in California (outside of the Bay Area), we offer a base pay of: $163,000 to $285,200<<ENTER PAY RANGE HERE>>, plus equity (when applicable), variable/incentive compensation and benefits. Sales positions generally offer a competitive On Target Earnings (OTE) incentive compensation structure. Please note that the base pay shown is a guideline, and individual total compensation will vary based on factors such as qualifications, skill level, competencies and work location. We also offer health plans, including flexible spending accounts, a 401(k) Plan with company match, ESPP, matching donations, a flexible time away plan and family leave programs.  Compensation is based on the geographic location in which the role is located, and is subject to change based on work location. For individuals who will be working in the Bay Area, there is a pay enhancement for positions located in that geographical area; please contact your recruiter for additional information.

See more jobs at ServiceNow

Apply for this job

17d

Senior Frontend Engineer

BloomreachBratislava, Slovakia/Prague, Czech Republic/Brno, Czech Republic (Remote CEE)
remote-firstDesignswiftuiapiUXgitc++typescriptcssangularjavascriptfrontend

Bloomreach is hiring a Remote Senior Frontend Engineer

Bloomreach is the world’s #1 Commerce Experience Cloud, empowering brands to deliver customer journeys so personalized, they feel like magic. It offers a suite of products that drive true personalization and digital commerce growth, including:

  • Discovery, offering AI-driven search and merchandising
  • Content, offering a headless CMS
  • Engagement, offering a leading CDP and marketing automation solutions

Together, these solutions combine the power of unified customer and product data with the speed and scale of AI optimization, enabling revenue-driving digital commerce experiences that convert on any channel and every journey. Bloomreach serves over 850 global brands including Albertsons, Bosch, Puma, FC Bayern München, and Marks & Spencer. Bloomreach recently raised $175 million in a Series F funding round, bringing its total valuation to $2.2 billion. The investment was led by Goldman Sachs Asset Management with participation from Bain Capital Ventures and Sixth Street Growth. For more information, visit Bloomreach.com.

 

Do you love frontend development and are you good at it? Would you like to build a large-scale & fast evolving app using Angular & TypeScript? Would you like to talk about why we might be the best team for you to join right now?? Curious? Read on!
(Your s
alary starts from 3300€ per monthwith stock options and other benefits included. Working in one of ourCentral Europe offices or from homeon afull-time basis.)

What tech stack do we have for you?

  • Typescript and Javascript
  • Angular
  • SCSS/CSS
  • NodeJS
  • RxJS
  • Karma/Jasmine/Cypress
  • GIT

About your role and the team:

We are a team of thirteen people at the moment. We cooperate tightly as a single unit on a multitude of tasks and challenges in order to make our application the best to serve our customers’ needs. Since not all of us enjoy tasks with a focus on styling, a subteam of stylers has been formed that takes care of our UI library of low-level components. 

We are facing a variety of tasks on our daily basis that fall mostly into three categories - designing and developing new features, maintaining existing features in the underlying codebase and sometimes prototyping new features as POCs.

What we expect of the candidate:

Must have

  • advanced TypeScript (or JavaScript with a strong will to switch to TypeScript)
  • advanced Angular (or similar component-based framework with a strong will to switch to Angular)
  • experience with software design & architecture (be able to propose and implement an effective & efficient solution based on problem definition without detailed instructions)
  • The ability to work in project teams effectively, being reliable and communicating clearly.
  • A “can-do” attitude

Should have

  • experience with developing bigger projects
  • At least an intermediate skill with SCSS / CSS (be able to get things done in reasonable quality if your styler colleagues are busy)

Preferably have

  • experience with testing (Karma, Jasmine, Cypress)
  • experience with RxJS

Nice have

  • experience with mentoring less experienced colleagues

How we work:

Our entire engineering team works in 6 week cycles. Each developer is assigned to one or more projects during this cycle and aims to deliver the project together with other project team members from various other teams. In addition to working on projects, we also focus on other tasks - not limited to working on our backlog, providing an L3 support to our client facing colleagues or making improvements to our product through an initiative called “Happy consultants”.
In order to keep our high quality standards, each change in code we do gets reviewed and our automated pipeline builds these changes, runs a series of tests, runs the linter, packages the outputs and deploys them onto a development environment.
We are a team of diverse skill sets - you will need to share your experience and knowledge (during code reviews and ideally also beyond) with other colleagues and help them grow just like we all will help and support you from the minute you join us.

Challenges:

Here are some of the challenges that kept us busy in the past:

  • Micro frontend research
    • Our application is split up into modules but we are experimenting with the idea of loosening up the coupling even a bit more and splitting our large application into a collection of smaller ones run under a single container application.
    • Identify the pros and cons of this approach and what problems will it solve effectively and what other problems it might bring.
    • Take into account how this switch potentially affects not the architecture alone but also the execution, deployment and DX.
  • Optimizing build performance
    • The larger an application gets, the more complex the build becomes. Our application consists of hundreds of components, directives, services, pipes and other functions.
    • Find a way to optimise the build in order to make the DX and the pipeline build performance better.
  • Optimizing change detection
    • Our application aims to deliver a swift interaction experience to its users without the feeling that something is lagging.
    • Identify components that are underperforming.
    • Analyze their bottlenecks using the profiler.
    • Optimize the runtime performance of the problematic code parts.
  • Data visualisation
    • Our real-time analyses like trends, funnels, reports, and segmentations allow users to gain insights about their data from multiple perspectives. We integrate with external data sources spanning multiple relational databases and big data storage systems.
    • Build an interface for users to query data from data sources located outside of the Engagement to build the basis for our analyses and visualizations.
    • Create complex data visualizations using the Highcharts library or similar suitable tool.
    • Be proactive in proposing solutions which will help users to better understand their data.
    • Improve test quality and extend test coverage.
  • Extend UI library
    • We have created a mature UI library with the goal in mind to unify the look, behavior, and the API of our reusable components. This library already consists of a solid foundation of components but the innovation in the Engagement goes hand in hand with the need to create new components and enhance existing ones.
    • Create new reusable components while focusing on clear API, stability, best possible UX and modern browser support.
    • Test your component well. Use unit tests to cover all thinkable and unthinkable scenarios your component may go through to make it robust.
  • Other than that…
    • We work hard to have sustainable code, but we still have some code in our codebase, especially from the early startup era, that was written in haste to keep the business running - you will need to be able to get around in complex code and help us refactor it.
    • Automated testing of our code is important to us. You will need to cover your code, help us improve existing test quality and extend overall test coverage - spanning from unit tests, through integration tests to automated e2e tests.

Regional benefits:

  • Monthly lunch entitlement by up to 110€ per month
  • Pension scheme or Health insurance depending on region

#LI-DU1

More things you'll like about Bloomreach:

Culture:

  • A great deal of freedom and trust. At Bloomreach we don’t clock in and out, and we have neither corporate rules nor long approval processes. This freedom goes hand in hand with responsibility. We are interested in results from day one. 

  • We have defined our5 valuesand the 10 underlying key behaviors that we strongly believe in. We can only succeed if everyone lives these behaviors day to day. We've embedded them in our processes like recruitment, onboarding, feedback, personal development, performance review and internal communication. 

  • We believe in flexible working hours to accommodate your working style.

  • We work remote-first with several Bloomreach Hubs available across three continents.

  • We organize company events to experience the global spirit of the company and get excited about what's ahead.

  • We encourage and support our employees to engage in volunteering activities - every Bloomreacher can take 5 paid days off to volunteer*.
  • TheBloomreach Glassdoor pageelaborates on our stellar 4.6/5 rating. The Bloomreach Comparably page Culture score is even higher at 4.9/5

Personal Development:

  • We have a People Development Program -- participating in personal development workshops on various topics run by experts from inside the company. We are continuously developing & updating competency maps for select functions.

  • Our resident communication coachIvo Večeřais available to help navigate work-related communications & decision-making challenges.*
  • Our managers are strongly encouraged to participate in the Leader Development Program to develop in the areas we consider essential for any leader. The program includes regular comprehensive feedback, consultations with a coach and follow-up check-ins.

  • Bloomreachers utilize the $1,500 professional education budget on an annual basis to purchase education products (books, courses, certifications, etc.)*

Well-being:

  • The Employee Assistance Program -- with counselors -- is available for non-work-related challenges.*

  • Subscription to Calm - sleep and meditation app.*

  • We organize ‘DisConnect’ days where Bloomreachers globally enjoy one additional day off each quarter, allowing us to unwind together and focus on activities away from the screen with our loved ones.

  • We facilitate sports, yoga, and meditation opportunities for each other.

  • Extended parental leave up to 26 calendar weeks for Primary Caregivers.*

Compensation:

  • Restricted Stock Units or Stock Options are granted depending on a team member’s role, seniority, and location.*

  • Everyone gets to participate in the company's success through the company performance bonus.*

  • We offer an employee referral bonus of up to $3,000 paid out immediately after the new hire starts.

  • We reward & celebrate work anniversaries -- Bloomversaries!*

(*Subject to employment type. Interns are exempt from marked benefits, usually for the first 6 months.)

Excited? Join us and transform the future of commerce experiences!

If this position doesn't suit you, but you know someone who might be a great fit, share it - we will be very grateful!


Any unsolicited resumes/candidate profiles submitted through our website or to personal email accounts of employees of Bloomreach are considered property of Bloomreach and are not subject to payment of agency fees.

 #LI-Remote

See more jobs at Bloomreach

Apply for this job

17d

Senior Backend Engineer, Access Control

WebflowU.S. Remote
agileremote-firstqac++typescriptjavascriptbackendNode.js

Webflow is hiring a Remote Senior Backend Engineer, Access Control

At Webflow, our mission is to bring development superpowers to everyone. Webflow is the leading visual development platform for building powerful websites without writing code. By combining modern web development technologies into one platform, Webflow enables people to build websites visually, saving engineering time, while clean code seamlessly generates in the background. From independent designers and creative agencies to Fortune 500 companies, millions worldwide use Webflow to be more nimble, creative, and collaborative. It’s the web, made better. 

We’re looking for a Senior Software Engineer to join the Access Control team to enable our engineering team to build more efficiently so we can further our mission of bringing visual development superpowers to everyone.

About the role 

  • Location: Remote-first (United States; BC & ON, Canada) 
  • Full-time 
  • Permanent
  • Exempt 
  • The cash compensation for this role is tailored to align with the cost of labor in different geographic markets. We've structured the base pay ranges for this role into zones for our geographic markets, and the specific base pay within the range will be determined by the candidate’s geographic location, job-related experience, knowledge, qualifications, and skills.
    • United States  (all figures cited below in USD and pertain to workers in the United States)
      • Zone A: $162,500 - $216,050
      • Zone B: $152,700 - $203,100
      • Zone C: $143,00 - $190,150 
    • Canada  (All figures cited below in CAD and pertain to workers in ON & BC, Canada)
      • CAD 184,600 - CAD 245,500
  • Please visit our Careers page for more information on which locations are included in each of our geographic pay zones. However, please confirm the zone for your specific location with your recruiter.

  • Reporting to the Senior EM 

As Senior Software Engineer, you’ll: 

  • Build and maintain shared services and user interfaces including, but not limited to: access control, permission capabilities, and other permission management aspects of the system
  • Collaborate with software engineers, product managers, designers, and QA analysts in an autonomous, supportive team environment
  • Identify, develop, and document APIs for Webflow’s internal and external access control systems
  • Solve problems in a highly technical platform that empowers thousands of users
  • Improve our planning, development, and deployment processes to help you and your fellow team members
  • Mentor, coach, and inspire a team members of various levels

In addition to the responsibilities outlined above, at Webflow we will support you in identifying where your interests and development opportunities lie and we'll help you incorporate them into your role.

About you 

You’ll thrive in this role if you:

  • Have 5+ years developing and deploying web applications, with a proven track record of shipping to market.
  • Excellent organization and communication skills, both verbal and written.
  • Experience with innovating incremental solutions within existing systems 
  • Have worked on complex issues where the analysis requires an in-depth knowledge of the product and existing architecture.
  • Can debug production issues across services and multiple levels of the stack
  • Take pride in taking ownership and driving projects to business impact
  • Proven experience building complex web systems, including testing and documentation
  • Are familiar with one or more Javascript type systems (we use TypeScript here) and have some node.js experience
  • Are comfortable working in an agile, safe-to-fail environment

Our Core Behaviors:

  • Obsess over customer experience. We deeply understand what we’re building and who we’re building for and serving. We define the leading edge of what’s possible in our industry and deliver the future for our customers
  • Move with heartfelt urgency. We have a healthy relationship with impatience, channeling it thoughtfully to show up better and faster for our customers and for each other. Time is the most limited thing we have, and we make the most of every moment
  • Say the hard thing with care. Our best work often comes from intelligent debate, critique, and even difficult conversations. We speak our minds and don’t sugarcoat things — and we do so with respect, maturity, and care
  • Make your mark. We seek out new and unique ways to create meaningful impact, and we champion the same from our colleagues. We work as a team to get the job done, and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates

Benefits & wellness

    • Equity ownership (RSUs) in a growing, privately-owned company
    • 100% employer-paid healthcare, vision, and dental insurance coverage for employees and dependents (full-time employees working 30+ hours per week), as well as Health Savings Account/Health Reimbursement Account, dependent care Flexible Spending Account (US only), dependent on insurance plan selection where applicable in the respective country of employment; Employees may also have voluntary insurance options, such as life, disability, hospital protection, accident, and critical illness where applicable in the respective country of employment
    • 12 weeks of paid parental leave for both birthing and non-birthing caregivers, as well as an additional 6-8 weeks of pregnancy disability for birthing parents to be used before child bonding leave (where local requirements are more generous employees receive the greater benefit); Employees also have access to family planning care and reimbursement
    • Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations (where local requirements are more generous employees receive the greater benefit), and sabbatical program
    • Access to mental wellness and professional coaching, therapy, and Employee Assistance Program
    • Monthly stipends to support health and wellness, smart work, and professional growth
    • Professional career coaching, internal learning & development programs
    • 401k plan and pension schemes (in countries where statutorily required) financial wellness benefits, like CPA or financial advisor coverage
    • Discounted Pet Insurance offering (US only)
    • Commuter benefits for in-office employees

    Be you, with us

    At Webflow, equality is a core tenet of our culture. We are an Equal Opportunity (EEO)/Veterans/Disabled Employer and are committed to building an inclusive global team that represents a variety of backgrounds, perspectives, beliefs, and experiences. Employment decisions are made on the basis of job-related criteria without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, veteran status, or any other classification protected by applicable law. Pursuant to the San Francisco Fair Chance Ordinance, Webflow will consider for employment qualified applicants with arrest and conviction records.

    Stay connected

    Not ready to apply, but want to be part of the Webflow community? Consider following our story on our Webflow BlogLinkedInX (Twitter), and/or Glassdoor.

    Please note:

    To join Webflow, you'll need valid U.S. or Canadian work authorization depending on the country of employment.

    If you are extended an offer, that offer may be contingent upon your successful completion of a background check, which will be conducted in accordance with applicable laws. We may obtain one or more background screening reports about you, solely for employment purposes.

    For information about how Webflow processes your personal information, please review Webflow’s Applicant Privacy Notice

See more jobs at Webflow

Apply for this job

17d

Tech lead Full Stack

DevoteamRabat, Morocco, Remote
agileDesignmongodbsassgitjavadockerpostgresqlmysqltypescriptcsskubernetesangularAWSjavascript

Devoteam is hiring a Remote Tech lead Full Stack

Description du poste

LES MISSIONS DU DEVELOPPEUR FULL-STACK JAVA/ANGULAR

  • Vous interviendrez sur les nombreux projets et problématiques de nos clients,
  • Vous participerez activement aux phases projet (analyse/développement, mise en place
    et livraison) en proposant des solutions.
  • Vous réaliserez “from scratch” des projets,
  • Vous adresserez les problématiques d’architecture, de testabilité, de maintenabilité en
    proposant des solutions,
  • Nous partagerons les bonnes pratiques et sujets innovants quotidiennement,
  • Nous apprendrons grâce à vous et vous apprendrez de nous,
  • Vous participerez à la vie du pôle web (BBL, crossDT, soirée technique, …),

LE CADRE DU DEVELOPPEMENT FULL-STACK JAVA/ANGULAR

  •  Java 10+ (Spring Boot, Spring Security, Spring JPA, Spring Data, Maven, Gradle), J2EE,Hibernate.
  • JavaScript (TypeScript, Angular 6+), SASS, Karma, Jasmine.
  • PostgreSQL, DynamoDB. MongoDB, MySQL, MS Server, H2.
  • AWS, Google Cloud, Microsoft Azure.
  • Git, Docker (Swarm, Rancher, Kubernetes, Compose).
  • Architecture SOA, WOA, Microservices.
  • Nous opérons dans un cadre de Devops (CI/CD), de la manière la plus agile possible.

Qualifications

De formation Bac+5, d’une École d’Ingénieur ou équivalent, tu es non seulement capable d’apprendre et de réaliser des développements en technologies web innovantes mais aussi de comprendre, débugger et maintenir des bases de code moins récentes.

Tu sais prendre du recul sur tes réalisations et celles de tes collègues, ainsi que proposer et mettre en places des améliorations. La qualité, la robustesse, l’optimisation et les performances, ainsi que la précision de l’interface sont des concepts qui importent pour toi.

Nous recherchons des personnes ayant déjà +5 années d’expérience en développement Java et Angular, ainsi qu’en intégration graphique & responsive design (HTML, CSS), et qui ont l’envie d’intervenir sur des projets ambitieux et de partager leur passion.

Alors si tout ceci te correspond, si tu souhaites progresser et produire, apprendre et partager, rejoins-nous !

See more jobs at Devoteam

Apply for this job

17d

Senior Software Engineer II

FlywireUSA Remote, US, Remote
Designmongodbhtml5javaelasticsearchmysqllinuxAWSjavascript

Flywire is hiring a Remote Senior Software Engineer II

Job Description

The Opportunity:

We, at Flywire, are looking for an experienced Sr. Software Engineer II, ideally with a background in FinTech. Your primary responsibility will be to build and maintain the platform that supports the money movement of our industry leading payment engine moving hundreds of millions everyday. 

You will be joining a team in charge of designing new functionalities and improving the current capabilities to improve speed, cost and scalability of our product. Thus, a commitment to collaborative problem solving, pragmatic design, building quality products and to convey the sensation that the product is the responsibility of all the team is essential. You will be responsible for ensuring high quality code in a team defined timeframe. 

  • Write clean, high quality, testable, secure, maintainable and extendable code
  • Solve items such as challenging bugs and production issues within the development environment
  • Work on complex issues where analysis of situations or data requires an in-depth evaluation of variable factors.
  • Exercise judgment in selecting methods, techniques and evaluation criteria for obtaining results
  • Understand scalability and performance status and make improvement for scalability
  • Drive change and improvement in all phases of the development lifecycle
  • Partake in the recruitment process by identifying and exciting great talent
  • Ensure the best possible performance, quality, and responsiveness of the applications
  • Contribute to the product vision by collaborating with Product Managers and stakeholders
  • Drive initiatives to lead projects as well as mentor team members

Qualifications

Here’s What We’re Looking For:

  • 8+ years of experience in Java
  • Experience in designing, developing and supporting scalable, performant and reliable web applications and distributed systems
  • Seasoned in techniques such TDD and BDD
  • Proficient working with continuous integration and delivery (CI/CD)
  • Understanding of relational databases 
  • Strong understanding of object-oriented fundamentals
  • Great understanding of the other disciplines in the cross functional team: QAs, Product and SREs
  • Outstanding verbal and written communication skills and the ability to collaborate with cross functional teams including product and support 
  • Experience in FinTech or the payment industry will be appreciated
  • The ability to deliver high quality code and learn quickly

Technologies We Use:

  • Java 
  • React
  • JavaScript, HTML5, and CSS3 
  • System management: Linux, MySQL, MongoDB, Redis, Sidekiq, AMQP, ElasticSearch,
  • Machine Learning
  • Cloud platform: AWS

See more jobs at Flywire

Apply for this job

18d

Senior Software Engineer (Hybrid/Remote)

Oasis Africa Consulting LimitedJakande, Lekki, Nigeria, Remote
agileDesignhtml5scrumapiqagittypescriptAWSjavascriptbackendNode.js

Oasis Africa Consulting Limited is hiring a Remote Senior Software Engineer (Hybrid/Remote)

Job Description

 

Desired Abilities- Ability to:

Design, develop, and maintain high-quality, scalable, and secure software solutions using Node.js, TypeScript, and AWS technologies.

Collaborate with cross-functional teams, including product management, UX/UI design, and QA, to gather requirements, define specifications, and ensure the successful delivery of projects.

Architect and implement efficient, maintainable, and modular code in javascript and Typescript, adhering to best practices, coding standards, and established guidelines.

Optimise application performance by identifying bottlenecks, implementing solutions, and conducting regular code reviews.

Leverage AWS services and tools to design and implement cloud-native applications, ensuring optimal performance, security, and cost-effectiveness.

Participate in the entire software development lifecycle, from planning and design to deployment and maintenance, ensuring smooth project execution.

Stay up-to-date with industry trends, emerging technologies, and best practices in software engineering, particularly within the Node.js, TypeScript, and AWS ecosystems.

Troubleshoot, diagnose, and resolve software issues, providing timely and practical solutions to ensure minimal user disruption.

Collaborate with the other engineering team members to ensure smooth CI/CD pipelines, infrastructure management, and monitoring and alerting systems.

 

You could be an ideal match if you possess:

4+ years of professional experience in software development, focusing on web applications and backend services using JavaScript, TypeScript, and Node.js. You will need to have strong proficiency in JavaScript, TypeScript, and Node.js with a deep understanding of core concepts, asynchronous programming, and performance optimisation techniques.

2+ years of experience working with front-end frameworks, preferably Vue.js - and a solid understanding of HTML5, CSS3, and related web technologies - in building user-friendly and responsive web applications.

Familiarity with Agile development methodologies, such as Scrum or Kanban, and experience working in an Agile environment.

Some experience with NestJS, a progressive Node.js framework, and familiarity with its underlying principles, such as dependency injection and modularity, is a plus.

Knowledge of Domain-Driven Design (DDD) concepts and experience implementing DDD principles in software projects is valuable.

Familiarity with AWS services such as EC2, S3, Lambda, API Gateway, RDS, and Load balancers, and experience building scalable and secure cloud-based applications.

Knowledge of RESTful API design principles.

Experience with version control systems, preferably Git, and understanding of best code management and collaboration practices.

Proficiency in writing and maintaining unit, integration, and end-to-end tests using testing frameworks such as Jest, Mocha, or Jasmine.

Good knowledge of software development best practices, including design patterns, code modularity, and maintainability.

Strong problem-solving skills, with the ability to analyse complex issues, develop practical solutions, and adapt to changing requirements.

Excellent communication and collaboration skills, with the ability to work effectively in a team-oriented environment.

Qualifications

 

An engineering degree is not a prerequisite; instead, we highly value relevant experience in software development and a demonstrable portfolio of projects that highlight your skills.

See more jobs at Oasis Africa Consulting Limited

Apply for this job

18d

Senior Full Stack Software Engineer - Cloud Applications

JitterbitSão Paulo, Brazil, Remote
DesignapijavadockerelasticsearchmysqltypescriptcsskuberneteslinuxangularAWSjavascriptNode.js

Jitterbit is hiring a Remote Senior Full Stack Software Engineer - Cloud Applications

Job Description

Jitterbit is seeking a Senior Full Stack Software Engineer to join our Cloud Applications team. Jitterbit is an iPaaS (Integration as a Service) and API Management platform who has been recognized in the leader quadrant of Gartner for five straight years. Our customers use our iPaaS and APIM platform to solve mission critical business problems. What is our challenge? To make it easy to integrate our customers’ systems. In order to do this, we need to build and create a SaaS offering that is reliable, stable, and scalable for our customers. Do you have the design, architecting, and code-writing capabilities to take on this challenge? And can succeed in a big way?

ABOUT THE TEAM

The engineering team at Jitterbit believes that the quality of our code reflects directly on us as professionals. We are relentless about crafting a product that is innovative and delivers a memorable user experience; an experience that is fast and robust. As a key engineer on our team, you will collaborate with other engineers, product management, and operations. Our culture is fun, fast-paced, performance-oriented, open, and collegial. We are constantly pushing the technology envelope to the edge! We are very distributed and our culture is set up to make all of us very effective working remotely. We believe in hiring talent where it exists.

ABOUT THE JOB

You will be helping us build, design, and architect awesome and new capabilities on our various Cloud Application products. We are looking for a senior full stack engineer. You will be working with Angular, TypeScript, Node.js, CSS3, Nginx, Tomcat, Kafka, Elasticsearch, MySQL, Linux, Docker, and Kubernetes; to name a few of the technologies we use in our Cloud Apps team. You will have full lifecycle responsibilities to create robust, scalable, and distributed systems that operate flawlessly 24x7x365. You will have an opportunity to learn new things. We’re always expanding into new areas, exploring new technologies and pushing the frontier of our platform.This is an exciting opportunity to work in a highly innovative environment with new technologies as we continue to extend our market leading position.

Qualifications

ABOUT YOU

You are an engineer who can turn ideas into extremely reliable and scalable designs. You code in such a way that other engineers find your code easy to comprehend, modify, and build upon. You believe in the power of Integration and APIs to transform how systems are integrated and how applications are built.

You will be successful in this role if you:

  • Enjoy helping and mentoring others around you as you grow and become a successful engineer and developer
  • Have excellent written and verbal communication skills
  • Are capable of working in a distributed team and able to excel in a remote culture
  • Are self-driven and able to work on key initiatives
  • Take pleasure in making things happen and listen to the input from peers
  • Are able to make data driven decisions
  • Are a believer in a best idea strategy regardless of where or who ideas come from

We are looking for:

  • 5-8+ years of experience in building large scale distributed applications.
  • Strong experience building multi-tenant SaaS applications
  • Strong problem-solving, debugging, and analytical skills with great attention to detail
  • Experience with Microservices and Cloud-based architectures/design patterns

Technical Skills and Experience:

  • Excellent JavaScript, CSS and HTML authoring skills.
  • Proficiency with Javascript, TypeScript, Java Node.js, or Go.
  • Familiar with application deployment via Docker and/or Kubernetes.
  • Hands-on experience with AWS services such as DynamoDB, S3, or CloudFront.
  • Bonus: Experience using DataDog APM and logging.
  • Bonus: Experience developing and releasing using CI/CD pipelines, such as GitHub Actions

See more jobs at Jitterbit

Apply for this job

19d

Full-Stack Software Engineering Intern

MozillaRemote Canada
sqlDesignapic++javascript

Mozilla is hiring a Remote Full-Stack Software Engineering Intern

Hiring Ranges:

Remote Toronto: CAD 30.00 per Hour.

To learn more about our Hiring Range System, please click thislink.

Why Mozilla?

Mozilla Corporation is the non-profit-backed technology company that has shaped the internet for the better over the last 25 years. We make pioneering brands like Firefox, the privacy-minded web browser, and Pocket, a service for keeping up with the best content online. 

Now, with more than225million people around the world using our products each month, we’re shaping the next 25 years of technology. Our work focuses on diverse areas including AI, social media, security and more. And we’re doing this while never losing our focus on our core mission – to make the internet better for everyone. 

The Mozilla Corporation is wholly owned by the non-profit 501(c) Mozilla Foundation. This means we aren’t beholden to any shareholders — only to our mission. Along with60,000+ volunteer contributors and collaborators all over the world, Mozillians design, build and distributeopen-sourcesoftware that enables people to enjoy the internet on their terms.

About this team and role:

Mozilla isn’t just a great place to work. It’s an experience you’ll carry with you throughout your career. As part of our internship program, you’ll have the opportunity to be mentored one-on-one by somebody brilliant, to impact the projects you’ll collaborate on, and to never be bored. Ever. From the passionate people you’ll learn from, to the chances you’ll have to make the Web a better place, your time with Mozilla will be unlike any other.

We are hiring for multiple Firefox Fullstack teams - each solving their own unique challenges to make the web better for everyone. More details about all hiring teams will be shared in the interviews. 

Below is a small snapshot of the work we do to give you an idea about some of the big things you could do at Mozilla.

What you'll do:

  • Work on one of the world’s largest and most important open source codebases - the Firefox Desktop Browser.
  • Work with a world class engineering organization solving problems at internet skill. Your work will positively affect hundreds of millions of folks worldwide.
  • Write code and tests, build prototypes, tackle problems with no clear solution, collaborate with other designers and engineers to make the web a better place.
  • Learn about a wide variety of problems and solutions across a large, mature codebase.
  • Work with driven, committed team members to bring the open web to people around the world.

What you'll bring:

  • You have experience with programming in JavaScript, HTML, and CSS. Knowledge of C/C++ and/or Rust is a plus.
  • Familiarity with SQL and relational databases is an asset.
  • Experience with API / Interface design 
  • You speak English fluently and enjoy conducting software engineering work in the open.
  • You are enrolled in a university and are available to come to our Toronto offices during regular working hours depending on your schedule.
  • You know how to identify a problem, come up with a logical solution, and use the knowledge to tackle similar problems in future.
  • You have an interest in and ability to work with a distributed team (which requires good asynchronous written communication skills as well as good verbal communication skills).
  • You are happy to provide and receive constructive feedback; when you see something that can be improved, you act on it.
  • You can build consensus on complex issues, through your empathy, internal credibility and visibility.
  • Unafraid of asking questions, and proposing new ideas if you think they will make a positive impact.
  • A love of helping your colleagues grow and get better at what they do.

We value a variety of voices within our team and at Mozilla. You don't need to check every box on this list to apply.

About Mozilla 

When you work at Mozilla, you give yourself a chance to make a difference in the lives of web users everywhere. And you give us a chance to make a difference in your life every single day. Join us to work on the web as the platform and help create more opportunity and innovation for everyone online.  We’re not a normal tech company. The things we create prioritize people and their privacy over profits. We exist to make the internet a healthier,  happier place for everyone

Commitment to diversity, equity and inclusion

Mozilla believes in the value of diverse creative practices and forms of knowledge, and knows diversity, equity and inclusion are crucial to and enrich the company’s core mission. We encourage applications from everyone, including members of all equity-seeking communities, such as (but not limited to) women, racialized and Indigenous persons, persons with disabilities, persons of all sexual orientations, gender identities and expressions.

We will ensure that qualified individuals with disabilities are provided reasonable accommodations to participate in the job application or interview process, to perform essential job functions, and to receive other benefits and privileges of employment, as appropriate. Please contact us at hiringaccommodation@mozilla.com to request accommodation.
 
We are an equal opportunity employer. We do not discriminate on the basis of race (including hairstyle and texture), religion (including religious grooming and dress practices), gender, gender identity, gender expression, color, national origin, pregnancy, ancestry, domestic partner status, disability, sexual orientation, age, genetic predisposition, medical condition, marital status, citizenship status, military or veteran status, or any other basis covered by applicable laws. Mozilla will not tolerate discrimination or harassment based on any of these characteristics or any other unlawful behavior, conduct, or purpose.
 
Req ID: R2337

See more jobs at Mozilla

Apply for this job

19d

Full-Stack Software Engineer (PHP/ReactJS)

LoyaltekBrussels, BR Remote
5 years of experiencelaravelDesignapipostgresqlmysqlAWSjavascriptbackendfrontendPHP

Loyaltek is hiring a Remote Full-Stack Software Engineer (PHP/ReactJS)

Full-Stack Software Engineer (PHP/ReactJS)

Location: Brussels (Hybrid or Remote) Status: Freelancer Starting: ASAP

Giftify is a FinTech/MarTech scale-up leader in turn-key Gift Card solutions for Shopping Centres and retailers across Europe. Our goal is to become the world leader in our industry.

Through our Gift Card products, our passion is to bring efficient and innovative solutions to allow Shopping Centres and Retail Parks to raise and revolutionize their marketing strategy 'one gift card at a time'.

Your mission, should you choose to accept it

We are seeking a passionate Full-Stack Software Engineer to join our team. The ideal candidate will have a strong background in translating complex problems into simple and reliable code. As a key member of our team, you will be responsible for analyzing and implementing new features within our application from both frontend and backend perspectives. This includes areas such as payment processing, API endpoints, tokenization, virtual cards, administration tools, graphics, and reports.

Responsibilities

  • Develop and implement new features across frontend and backend systems.
  • Collaborate with the team to ensure high-quality code and efficient performance.
  • Contribute to the continuous improvement of development processes and best practices.
  • Assist in bug fixing and troubleshooting to maintain system reliability.
  • Share knowledge and mentor colleagues to enhance team capabilities.

Mandatory hard skills

  • Minimum 5 years of experience in a similar role.
  • Proficiency in PHP 8.2 with modern features such as types and annotations.
  • Strong expertise in Laravel 10, including cache, queues, Eloquent ORM, and Laravel Passport.
  • Mastery of React, JavaScript, and TypeScript.
  • Knowledge of ReactNative is a plus.

The 5-legged goat (or assets)

  • Experience with testing strategies such as unit testing, integration testing, and TDD.
  • Proficiency in RESTful API design using tools like OpenAPI and Postman.
  • Familiarity with relational databases like MySQL or PostgreSQL, including optimization and design.
  • Collaborative development using pull requests.
  • Familiarity with CI/CD, DevOps, IaC, AWS is advantageous.

Soft skills

  • Proficient written and oral English communication (level B2 or above).
  • Strong team player comfortable with pair programming.
  • Ownership and accountability for work delivered.
  • Ability to share knowledge and expertise with the team.

Even if you're not a Superhero

Don't meet every requirement? Don't hesitate to apply! We value diverse experiences and perspectives, and we're committed to adding new talent to our team.

Recruitment process

  • Stage 1: Initial meeting with our recruiter to assess suitability.
  • Stage 2: Technical exercise to demonstrate skills.
  • Stage 3: Presentation of solution to Technical Director for further discussion and alignment.

Join us in revolutionizing the Gift Card industry and shaping the future of marketing strategies. Apply now and be part of our exciting journey!

See more jobs at Loyaltek

Apply for this job

19d

SAP Fiori Developer

ChabezTechDenver, CO, Remote
jqueryhtml5javascript

ChabezTech is hiring a Remote SAP Fiori Developer

Job Description

Title: SAP Fiori Developer
Location: Remote
Duration: Long Term

Requirements:
-- Proven experience as an SAP Fiori Developer or similar role, with at least 8 years of experience.
-- Strong proficiency in SAP Fiori development technologies including SAPUI5, Fiori Elements, OData services, and SAP Gateway.
-- Hands-on experience with SAP Fiori launchpad configuration and Fiori app deployment.
-- Proficient in JavaScript, HTML5, CSS3, and jQuery for front-end development.
-- Experience with SAP ABAP development and debugging.
-- Knowledge of SAP Fiori security concepts and best practices.
-- Excellent analytical and problem-solving skills with a keen attention to detail.
-- Strong communication and interpersonal skills, with the ability to collaborate effectively with cross-functional teams.
-- SAP Fiori certification is a plus.

Qualifications

See more jobs at ChabezTech

Apply for this job

19d

SDET/Test Automation QA Engineer

SonderMindDenver, CO or Remote
agilepostgresscrumapiqagitrubyc++elasticsearchtypescriptangularjenkinsAWSjavascript

SonderMind is hiring a Remote SDET/Test Automation QA Engineer

About SonderMind

At SonderMind, we know that therapy works. SonderMind provides accessible, personalized mental healthcare that produces high-quality outcomes for patients. SonderMind's individualized approach to care starts with using innovative technology to help people not just find a therapist, but find the right, in-network therapist for them, should they choose to use their insurance. From there, SonderMind's clinicians are committed to delivering best-in-class care to all patients by focusing on high-quality clinical outcomes. To enable our clinicians to thrive, SonderMind defines care expectations while providing tools such as clinical note-taking, secure telehealth capabilities, outcome measurement, messaging, and direct booking.

To follow the latest SonderMind news, get to know our clients, and learn about what it’s like to work at SonderMind, you can follow us on InstagramLinkedin, and Twitter

About the Role

As an SDET/Test Automation QA Engineer, you will have a passion for successfully developing robust and scalable testing frameworks to continuously improve quality, reduce cycle time, and bake efficiency into our development and testing processes. You will work closely with Product and Support teams to consistently advocate for end-users by ensuring the SonderMind platform is stable and meets the functional requirements. You strive for quality releases and exceeding customer expectations.    

Essential Functions 

  • Create and maintain automated and manual test cases
  • Assist with any manual testing needs on the team
  • Participate and have input on QA direction discussions; own the QA processes on the team 
  • Accountable for testing all stories coming through the team
  • Work with other SDET’s and Manual testers to ensure cross team projects are thoroughly tested
  • Work closely with engineers  to understand the underlying architecture in the code to create more robust tests.

What does success look like?

  • Quickly integrates into the team and becomes familiar with tools, process, and culture of existing software development and testing life cycles. Tests while leveraging existing scripts and adds to and/or makes recommendations for improvement.
  • Start build and implementation of go-forward test automation framework(s).
  • Well versed in our go-forward automated testing strategy. Fully understands system architecture, business functionality and technical dependencies. The test automation framework is stable, reusable, and positively growing code coverage.

Who you are?

  • 4+ years of software test development experience with proficiency in Javascript, Typescript, or similar 
  • Experience in Unix scripting or equivalent command line tools 
  • Experience with designing and developing full stack test automation ( Protractor, Cypress, etc)  
  • Proficiency with continuous integration and continuous deployment pipelines and tools  (Gitlab CI, CircleCI, Jenkins)
  • Testing and automating RESTful API service calls via tools such as Postman, Bruno, or similar
  • Ability to lead creation and maintenance of advanced suites of automated scripts for the full stack
  • Source control, Git experience
  • Experience in communicating quality reporting and metrics of test execution results, including use in visibility dashboards
  • Strong understanding of SDLC processes specifically agile scrum methodology

Preferred Experience 

  • Test case management systems, including creating integrations with one 
  • Load & Performance Test Engineering
  • Demonstrated experience in designing automation creating modular test scripts for reuse
  • Coding or working familiarity with any of the following technologies: Angular, AWS Deployment , ElasticSearch, Unit testing RSpec, Jasmine or similar experience, Ruby on Rails, Postgres, Redis

Our Benefits 

The anticipated salary rate for this role is between $114,000-130,000 per year.

As a leader in redesigning behavioral health, we are walking the walk with our employee benefits. We want the experience of working at SonderMind to accelerate people’s careers and enrich their lives, so we focus on meeting SonderMinders wherever they are and supporting them in all facets of their life and work.

Our benefits include:

  • A commitment to fostering flexible hybrid work
  • A generous PTO policy 
  • Therapy coverage benefits to ensure our employees have access to the care they need
  • Competitive Medical, Dental, and Vision coverage with plans to meet every need, including HSA and FSA options
  • Employer-paid disability & AD&D to cover life's unexpected events. Not only that, we also cover the difference in salary for up to eight (8) weeks of short-term disability leave
  • Eight weeks of paid Parental Leave  (if the parent also qualifies for STD, this benefit is in addition)
  • 401K retirement plan with 100% matching on up to 4% of base salary

Application Deadline

This position will be an ongoing recruitment process and will be open until filled.

 

Equal Opportunity 
SonderMind does not discriminate in employment opportunities or practices based on race, color, creed, sex, gender, gender identity or expression, pregnancy, childbirth or related medical conditions, religion, veteran and military status, marital status, registered domestic partner status, age, national origin or ancestry, physical or mental disability, medical condition (including genetic information or characteristics), sexual orientation, or any other characteristic protected by applicable federal, state, or local laws.

Apply for this job

19d

Analista de Desenvolvimento de Software Sênior - Frontend - Vaga Exclusiva para Pessoas com Deficiência

ExperianSão Paulo, Brazil, Remote
figmahtml5c++typescriptcssjavascript

Experian is hiring a Remote Analista de Desenvolvimento de Software Sênior - Frontend - Vaga Exclusiva para Pessoas com Deficiência

Job Description

Área: ECS - Experian Consumer Services - BU Consumidor
Subárea: Score

  • Desenvolver e manter aplicações front-end de alto desempenho;
  • Realizar alinhamentos técnicos entre membros da squad e áreas cross;
  • Ajudar a equipe de negócios no discovery e em levantamentos técnicos de novas features;

Qualifications

  • Experiência significativa com Javascript (ES6+), HTML5, CSS e React;
  • Experiência no desenvolvimento de interfaces responsivas a partir de protótipos (Figma, Adobe Xd, etc);
  • Experiência em consumir BFF / REST APIs;
  • Conhecimento em Typescript e Next.js;
  • Conhecimento em testes de unidade e integração;
  • Conhecimento em conceitos de DevOps.

Diferenciais:

  • Conhecimento em Observabilidade;
  • Experiência em acessibilidade (HTML semântico, leitores de tela, WCAG, etc);
  • Experiência em desenvolvimento ágil;
  • Experiência em revisão de código;

See more jobs at Experian

Apply for this job

19d

Implementation Team Manager

CloudflareRemote Portugal
Designapic++pythonjavascript

Cloudflare is hiring a Remote Implementation Team Manager

About Us

At Cloudflare, we have our eyes set on an ambitious goal: to help build a better Internet. Today the company runs one of the world’s largest networks that powers approximately 25 million Internet properties, for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Available Locations: Lisbon or Remote Portugal

Implementation Team Manager, Professional Services

 

Overview:

We are seeking a highly motivated and experienced Implementation Team Manager for Professional Services who will be responsible for the technical delivery of consultative and hands-on-keyboard implementation and migration services for enterprise customers. 

 

You are the team enabler, point of reference and coach. You will grow and develop your team and make sure work loads are equally distributed within the team. You are personable and can provide constructive feedback when necessary. You will help escalate and identify issues quickly and efficiently and you will work with the other team leads and the global head to ensure proper regional & cross-regional coordination. You have a solid technical background along with leadership and management skills. 

 

Ultimately, you are passionate about technology, have the ability to explain complex technical concepts in easy-to-understand terms and you like coaching and teaching. You are naturally curious and an avid builder who is not afraid to get your hands dirty.

 

Requirements:

Demonstrable experience in:

  • Professional services delivery. 
  • Coaching, leadership skills or team management.
  • Owning and solving escalations, team issues or other management related scenarios.
  • Building processes, leveraging tools and Agile methodologies for operational excellence.
  • Deep understanding of how the Internet works. 
  • Layers and protocols of the OSI model, such as TCP/IP, UDP, TLS, DNS, HTTP.
  • Reverse and forward proxies and the application of both.
  • IPv4/6, VPNs, router and L3/L4 and next gen firewall configuration, SDN and overall IT networking related best practices.
  • Demonstrated experience with BGP (network architecture, design & implementation), tunneling technologies such as GRE & IPSec, MPLS, SD-WAN, NetFlow and/or sFlow.
  • 5+ years in a customer facing position. 
  • Ability to work with all levels of an organization (both internally and externally) with experience of both working cross-functionally and geographically. 
  • Strong interpersonal communication (verbal and written) and organizational skills.
  • Highly motivated, driven and passionate about technology and customer success.
  • Anticipates needs, innovates, multi-tasks and excels in a fast-paced environment.
  • Experience with Salesforce and the Atlassian Suite (Confluence/JIRA). 
  • The work will be performed in English. Fluency in a second European language is a must.

 

Inter-Team Goals

  • Cultivate cross team/office/region/global coordination, keep us all connected as one team.
  • Facilitate knowledge transfer between teams.  Ensure the team learns from the great ideas of single team members.  Ensure mistakes are not repeated within the team.
  • Develop strong relationships outside of the Professional Services organization to aid in escalation of issues (product/support/engineering/special projects/marketing/legal/etc).

 

Intra-Team Goals

  • Keep the pulse of the team: who is happy, productive, performing. Know each member’s strengths and how they would each like to develop.
  • Exemplify and cultivate positive culture traits.
  • Provide support and confidence to team members.
  • Cultivate a very open communication and diverse environment. Criticism is welcome and appreciated.
  • Maintain a culture of independence amongst team members whilst offering advice when appropriate.

 

Personal Goals

  • Maintain trust and respect from the team.
  • Ability to handle any call from any customer.

 

Responsibilities:

  • Project portfolio delivery, risk management, reporting, cost management, time management and stakeholder management. 
  • Workload Management.
  • Conduct 1:1’s with team members.
  • Act as a point of escalation for team issues, escalate issues that can’t be solved within the team.
  • Recruit, interview, and onboard new team members.
  • Report on individual IM’s strengths and weaknesses. Build and execute development plans.
  • Continuously improve the operating model: people, processes and tools evolve for success.

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job