graphql Remote Jobs

165 Results

+30d

Senior Software Engineer, Frontend

AtticusLos Angeles, CA or Remote
scalaDesigngraphqluiUXgitrubyjavac++dockercsskubernetesjenkinspythonAWSfrontend

Atticus is hiring a Remote Senior Software Engineer, Frontend

About Us

At any given time, 16 million Americans are experiencing a crisis that requires urgent help from our legal system or government. The right assistance could transform their lives. But today, most never get it. 

Atticus makes it easy for any person in crisis to get the life-changing aid they deserve. In just three years, we’ve become the leading platform connecting people with disabilities to government benefits. We also help victims of accidents, misconduct, and violence get compensation from insurance. So far, we’ve gotten thousands of people access to over $2B in life-changing aid, and we’re just getting started.

We've helped more than 20,000 people in need (see our 6,000+ five-star reviews) and raised more than $50 million from top VC firms like Forerunner, GV (Google Ventures), and True Ventures. (We just closed our Series B round in May 2023, so we're well-funded for the foreseeable future.) We're small but moving fast — our team grew from 32 to 60 last year and we expect to double in size again in 2023.

The Job

Atticus works in an industry dominated by outdated technology that is ripe for fresh thinking: our core competitors rely on massive call centers to screen clients, antiquated CRMs to track and manage cases, and paper checks to get paid (provided they’re sent to the right address). 

Conversely, as a VC-backed tech company our product & engineering department powers everything we do: from creating an engaging online experience for people in crisis to providing tools for our network lawyers as they serve our clients, Atticus relies on technology to fulfill our mission.

We’re looking for Software Engineers to join our team. You’ll work on the front-end, and will partner with every department at Atticus as we continue to grow our platform to help people in need find trusted legal support.  

What You'll Do:

  • Design, build and operate Atticus’ front-end applications written in React with a focus on performance, modularity, extensibility, and reliability.
  • Architect, design, write, review, and test code in a collaborative environment with other software engineers.
  • Work with product to evaluate and refine product details and acceptance criteria
  • Evaluate new front-end technologies and methodologies with an eye toward scalability and performance.
  • Leverage your peers as multipliers for your skills to create excellent products and services.

The role is a rare opportunity to join a fast-growing Series B startup that doubles as a B-corp social enterprise. Every project you take on will help clients in need get the help they deserve, and you’ll shape our company culture as we scale. We’re looking for engineers who are excited about our mission and the challenges it entails.

Who You Are:

  • You write idiomatic JavaScript/Node.js; Golang, Java, Python, Scala, or Ruby is helpful.
  • You have experience and love for building performant React applications
  • You speak CSS and HTML fluently and know how to build around browser limitations
  • You enjoy working with UI and UX experts to build compelling user experiences
  • You enjoy helping your teammates grow their front-end skillset
  • You use a modern version-control system for your source code repository (Git, Mercurial, GitHub, BitBucket).
  • You lint all your code or know you should.
  • You know what parts of your code require tests and you write those tests.
  • You use objective judgment in leveraging the right frameworks and technologies.
  • You are versed in cloud computing systems (GCP, AWS, etc.) and SAAS concepts.
  • You leverage continuous integration systems to their full extent (CircleCI, Bamboo, Jenkins, TravisCI).
  • You plan for, build, evolve and scrutinize monitoring and alerting for your production systems.
  • You are willing and able to deploy, troubleshoot, and maintain your systems in production and staging environments.

Extra Credit:

  • You like working with Google Cloud Platform, Kubernetes, Docker, Git, Golang, Java
  • You are well versed in working with GraphQL, GraphQL Federation, REST APIs and supporting network protocols
  • You can build a great Webpack configuration

We are strongly committed to building a diverse team. If you’re from a background that’s underrepresented in tech, we’d love to meet you!

Salary and Benefits

This is a rare opportunity to join a startup that has strong traction (substantial funding, well-respected backers, tremendous growth, and many happy customers) but is still small enough that you can have a huge impact and play a role in shaping our culture.

We’re a certified B Corporation tackling a critical social problem. Our mission to help people in need drives everything we do, and your work here will touch many lives.

We offer competitive pay — including equity — and generous benefits:

  • Medical and dental insurance with 100% of employee premiums covered
  • 15 vacation days & ~19 paid holidays each year (including two weeks at end-of-year)
  • Free membership to OneMedical
  • $1,000 reimbursable stipend for education and training outside of work
  • Student loan repayment assistance, 401(k), and optional HSA
  • Free snacks, drinks, weekly lunches, and regular team dinners/events/retreats
  • Humble, thoughtful, smart, fun colleagues 

We anticipate the base salary band for this role will be between $170,000 to $220,000 in addition to equity and benefits. The salary at offer will be determined by a number of factors such as candidate’s experience, knowledge, skills and abilities, as well as internal equity among our team.

Location & Covid

Today, about half our team are in Los Angeles or Phoenix (where we have offices) and half are fully remote and spread across the U.S. There are two options for this job:

  1. Live in Los Angeles, work a few days a week (or more) out of our beautiful office in the Arts District.
  2. Live wherever, work remotely, and travel to LA (on the company dime) as needed to be with your colleagues —somewhere between monthly and quarterly.

In short: You can do this job well remotely, and we’re committed to empowering everyone with flexibility. But we care a lot about building a great culture and we think some interactions need to happen in person, so we put a lot of thought into retreats, offsites, and other ways to gather. 

As for Covid: When the pandemic started, we immediately shifted to fully remote to protect our team and shuttered our office. Today, everyone on the team is vaccinated, and many come in often (though we don’t require it). Going forward, you can expect that vaccinations will be required for all employees (unless medically unable) and that if a variant emerges that makes in-person work unsafe for vaccinated people, we’ll close our office, cease any travel, and do whatever it takes to protect and support our team.

See more jobs at Atticus

Apply for this job

+30d

Senior Software Engineer, Backend

AtticusLos Angeles, CA or Remote
scalasqlDesigngraphqlgitjavac++dockerkubernetesjenkinspythonAWSjavascriptbackend

Atticus is hiring a Remote Senior Software Engineer, Backend

About Atticus

At any given time, 16 million Americans are experiencing a crisis that requires urgent help from our legal system or government. The right assistance could transform their lives. But today, most never get it. 

Atticus makes it easy for any person in crisis to get the life-changing aid they deserve. In just three years, we’ve become the leading platform connecting people with disabilities to government benefits. We also help victims of accidents, misconduct, and violence get compensation from insurance. So far, we’ve gotten thousands of people access to over $2B in life-changing aid, and we’re just getting started.

We've helped more than 20,000 people in need (see our 6,000+ five-star reviews) and raised more than $50 million from top VC firms like Forerunner, GV (Google Ventures), and True Ventures. (We just closed our Series B round in May 2023, so we're well-funded for the foreseeable future.) We're small but moving fast — our team grew from 32 to 60 last year and we expect to double in size again in 2023.

The Job

Atticus works in an industry dominated by outdated technology that is ripe for fresh thinking: our core competitors rely on massive call centers to screen clients, antiquated CRMs to track and manage cases, and paper checks to get paid (provided they’re sent to the right address). 

Conversely, as a VC-backed tech company our product & engineering department powers everything we do: from creating an engaging online experience for people in crisis to providing tools for our network lawyers as they serve our clients, Atticus relies on technology to fulfill our mission.

We’re looking for Software Engineers to join our team. You’ll work on the back-end, and will partner with every department at Atticus as we continue to grow our platform in an effort to help people in need find trusted legal support.  

What You'll Do:

  • Design, build and operate Atticus’ APIs with a focus on performance, modularity, extensibility, and reliability.
  • Work with product to evaluate and refine product details and acceptance criteria
  • Architect, design, write, review, and test code in a collaborative environment with other software engineers.
  • Evaluate storage technologies and methodologies with an eye toward scalability and performance.
  • Leverage your peers as multipliers for your skills to create excellent products and services.

The role is a rare opportunity to join a fast-growing Series B startup that doubles as a B-corp social enterprise. Every project you take on will help clients in need get the help they deserve, and you’ll shape our company culture as we scale. We’re looking for engineers who are excited about our mission and the challenges it entails.

Who You Are:

  • You write idiomatic JavaScript, Golang, Java, Python, Scala, or Ruby.
  • You build modern, resilient and operationally sane backend systems exemplifying industry standards (HTTP REST, GraphQL, Stream processing, Big Data).
  • You enjoy teaching and mentoring teammates on backend system best practices and architecture
  • You work well with product to clarify and translate requirements for teammates
  • You use a modern version-control system for your source code repository (Git, Mercurial, GitHub, BitBucket).
  • You lint all your code or know you should.
  • You know what parts of your code require tests and you write those tests.
  • You use objective judgment in leveraging the right frameworks and technologies.
  • You are versed in cloud computing systems (GCP, AWS, etc.) and SAAS concepts.
  • You leverage continuous integration systems to their full extent (CircleCI, Bamboo, Jenkins, TravisCI).
  • You plan for, build, evolve and scrutinize monitoring and alerting for your production systems.
  • You are willing and able to deploy, troubleshoot, and maintain your systems in production and staging environments.

Extra Credit:

  • Experience with Google Cloud Platform, Kubernetes, Docker, CircleCI, Git, Golang, Java
  • Experience with GraphQL, GraphQL Federation, REST APIs and supporting network protocols
  • Experience with a distributed SQL platform like CockroachDB or Google Spanner
  • Experience with Hadoop, MapReduce, or other “Big Data” systems

We are strongly committed to building a diverse team. If you’re from a background that’s underrepresented in tech, we’d love to meet you!

Salary and Benefits

This is a rare opportunity to join a startup that has strong traction (substantial funding, well-respected backers, tremendous growth, and many happy customers) but is still small enough that you can have a huge impact and play a role in shaping our culture.

We’re a certified B Corporation tackling a critical social problem. Our mission to help people in need drives everything we do, and your work here will touch many lives.

We offer competitive pay — including equity — and generous benefits:

  • Medical and dental insurance with 100% of employee premiums covered
  • 15 vacation days & ~19 paid holidays each year (including two weeks at end-of-year)
  • Free membership to OneMedical
  • $1,000 reimbursable stipend for education and training outside of work
  • Student loan repayment assistance, 401(k), and optional HSA
  • Free snacks, drinks, weekly lunches, and regular team dinners/events/retreats
  • Humble, thoughtful, smart, fun colleagues 

We anticipate the base salary band for this role will be between $160,000 to $220,000 in addition to equity and benefits. The salary at offer will be determined by a number of factors such as candidate’s experience, knowledge, skills and abilities, as well as internal equity among our team.

Location & Covid

Today, about half our team are in Los Angeles or Phoenix (where we have offices) and half are fully remote and spread across the U.S. There are two options for this job:

  1. Live in Los Angeles, work a few days a week (or more) out of our beautiful office in the Arts District.
  2. Live wherever, work remotely, and travel to LA (on the company dime) as needed to be with your colleagues —somewhere between monthly and quarterly.

In short: You can do this job well remotely, and we’re committed to empowering everyone with flexibility. But we care a lot about building a great culture and we think some interactions need to happen in person, so we put a lot of thought into retreats, offsites, and other ways to gather. 

As for Covid: When the pandemic started, we immediately shifted to fully remote to protect our team and shuttered our office. Today, everyone on the team is vaccinated, and many come in often (though we don’t require it). Going forward, you can expect that vaccinations will be required for all employees (unless medically unable) and that if a variant emerges that makes in-person work unsafe for vaccinated people, we’ll close our office, cease any travel, and do whatever it takes to protect and support our team.

See more jobs at Atticus

Apply for this job

+30d

Lead Engineer

agileremote-firstkotlinterraformpostgresDesignvuegraphqldockerpostgresqlkubernetes

Parsley Health is hiring a Remote Lead Engineer

About us:

Parsley Health is a digital health company with a mission to transform the health of everyone, everywhere with the world's best possible medicine. Today, Parsley Health is the nation's largest health care company helping people suffering from chronic conditions find relief with root cause resolution medicine. Our work is inspired by our members’ journeys and our actions are focused on impact and results.

The opportunity:

We’re looking for an experienced growth-focused Lead Engineer and leader with knowledge of multiple technologies that can lead a team to build exciting new features that support the Parsley Health mission. You will be joining a remote team of passionate engineers  In this role, you will work closely with marketing, engineering, product, design and customer reliability teams. Parsley Health is an outcome driven organization and your work will directly contribute to the company objectives:  expand the business nationally, improve activation, conversion, retention, and expansion of our healthcare products.

We work in a blameless environment and we take ownership and pride in our efforts. We like to work in small cross functional product pods where each pod owns the development lifecycle of their products. We follow agile development practices and encourage each pod to tailor the processes to their needs. Our teams are built on pillars of trust, humility and continuous improvement.

What you’ll do:

  • Take ownership of technical design, solutions, and initiatives by working directly with executives and the product team to build features or brand new applications for Parsley’s patients
  • Build modern, beautiful web applications that shape our members’ experiences, empower doctors and health coaches, and support our internal team
  • Work closely with our Design teams to design, spec and estimate new projects and features
  • Lead an amazing team of engineers and mentor team members
  • Foster high code quality, security and set best practices
  • Ideate with the leadership and product team to identify solutions to key initiatives or user problems

What you’ll need:

  • A full stack engineer with hands on-the-job experience in the following technologies:
    • Front-end frameworks: React, NextJs, Vue or Remix
    • Web services using Go or NodeJS
    • Data languages such as GraphQL and JSON
    • Relational databases like PostgreSQL
  • Previously delivered significant and impactful projects that you are proud of
  • Have a strong understanding of the infrastructure of microservice patterns, the relationship of domain services and front-end applications including authentication/authorization layers and event pattern using pubsub
  • Experienced in unit and integration testing
  • Be able to diagnose and remediate issues in existing systems
  • Have a good understanding of security and its role in the healthcare industry
  • Someone who takes a disciplined approach to development, testing, documentation, code structure and review in a team environment
  • Be able to own the development and lifecycle of an entire feature
  • Have an entrepreneurial mindset in venture-backed growth-stage startups
  • Thrive under pressure and with tight deadlines
  • Passionate about our mission to live healthier through revolutionary primary care, excited for the future of healthcare, and a personal belief in wellness

Nice-to-haves:

  • DevOps experience in one or all of the following platforms: Docker, Kubernetes, Terraform

Our tech stack:

  • GCP is our platform for all custom application development and services
  • Services are containerized and run in containerd
  • GraphQL is our service language for applications.
  • Current languages of choice are Golang (new services) and Kotlin (legacy).
  • Managed Postgres with Cloud SQL.
  • GitHub is our repository and CI/CD service.

Benefits and Compensation:

  • Equity Stake
  • 401(k) + Employer Matching program
  • Remote-first with the option to work from one of our centers in NYC or LA
  • Complimentary Parsley Health Complete Care membership
  • Subsidized Medical, Dental, and Vision insurance plan options
  • Generous 3+ weeks of paid time off
  • Annual professional development stipend

Parsley Health is committed to providing an equitable, fair and transparent compensation program for all employees.

The starting salary for this role is between $165,750 - $195,000, depending on skills and experience. We take a geo-neutral approach to compensation within the US, meaning that we pay based on job function and level, not location.

Individual compensation decisions are based on a number of factors, including experience level, skillset, and balancing internal equity relative to peers at the company. We expect the majority of the candidates who are offered roles at our company to fall healthily throughout the range based on these factors. We recognize that the person we hire may be less experienced (or more senior) than this job description as posted. If that ends up being the case, the updated salary range will be communicated with candidates during the process.


At Parsley Health we believe in celebrating everything that makes us human and are proud to be an equal opportunity workplace. We embrace diversity and are committed to building a team that represents a variety of backgrounds, perspectives, and skills. We believe that the more inclusive we are, the better we can serve our members. 


Important note:

In light of recent increase in hiring scams, if you're selected to move onto the next phase of our hiring process, a member of our Talent Acquisition team will reach out to you directly from an@parsleyhealth.comemail address to guide you through our interview process. 

    Please note: 

  • We will never communicate with you via Microsoft Teams
  • We will never ask for your bank account information at any point during the recruitment process, nor will we send you a check (electronic or physical) to purchase home office equipment

We look forward to connecting!

#LI-Remote

See more jobs at Parsley Health

Apply for this job

+30d

Staff Full Stack Engineer (Growth)

agileremote-firstkotlinpostgresDesignvuegraphqlpostgresql

Parsley Health is hiring a Remote Staff Full Stack Engineer (Growth)

About us:

Parsley Health is a digital health company with a mission to transform the health of everyone, everywhere with the world's best possible medicine. Today, Parsley Health is the nation's largest health care company helping people suffering from chronic conditions find relief with root cause resolution medicine. Our work is inspired by our members’ journeys and our actions are focused on impact and results.

The opportunity:

We’re looking for an experienced growth focused full stack engineer and leader with knowledge of multiple technologies that can lead a team to build exciting new features that support the Parsley Health mission. You will be joining a remote team of passionate engineers. In this role, you will work closely with marketing, engineering, product, design and customer reliability teams. Parsley Health is an outcome driven organization and your work will directly contribute to the company objectives: expand the business nationally, improve activation, conversion, retention, and expansion of our healthcare products.

We work in a blameless environment and we take ownership and pride in our efforts. We like to work in small cross functional product pods where each pod owns the development lifecycle of their products. We follow agile development practices and encourage each pod to tailor the processes to their needs. Our teams are built on pillars of trust, humility and continuous improvement.

Our tech stack:

  • GCP is our platform for all custom application development and services
  • Services are containerized and run in containerd
  • GraphQL is our service language for applications.
  • Current languages of choice are Golang (new services) and Kotlin (legacy).
  • Managed Postgres with Cloud SQL.
  • GitHub is our repository and CI/CD service.

What you’ll do:

  • Take ownership of growth ideas, analysis, and initiatives by working directly with executives and the marketing team to build out new concepts or products
  • Build modern, beautiful web applications that shape our members’ experiences, empower doctors and health coaches, and support our internal team
  • Work closely with our Design teams to design, spec and estimate new projects and features
  • Work as part of an amazing team of engineers while being a technical leader and mentor other team members
  • Foster high code quality, security and set best practices

What you’ll need:

  • A full stack engineer with 8+ years of experience
  • Have  3+ years of on-the-job experience in the following technologies:
    • Front-end frameworks: React, NextJs, Vue or Remix
    • Web services using Go, Kotlin or NodeJS
    • Data languages such as GraphQL and JSON
    • Relational databases like PostgreSQL
  • Have a strong understanding of the infrastructure of microservice patterns, the relationship of domain services and front-end applications including authentication/authorization layers and event pattern using pubsub
  • Experienced in unit and integration testing
  • Be able to diagnose and remediate issues in existing systems
  • Have a good understanding of security and its role in the healthcare industry
  • Someone who takes a disciplined approach to development, testing, documentation, code structure and review in a team environment
  • Be able to own the development and lifecycle of an entire feature
  • Have an entrepreneurial mindset in venture-backed growth-stage startups
  • Thrive under pressure and with tight deadlines
  • Passionate about our mission to live healthier through revolutionary primary care, excited for the future of healthcare, and a personal belief in wellness

Benefits and Compensation:

  • Equity Stake
  • 401(k) + Employer Matching program
  • Remote-first with the option to work from one of our centers in NYC or LA
  • Complimentary Parsley Health Complete Care membership
  • Subsidized Medical, Dental, and Vision insurance plan options
  • Generous 4+ weeks of paid time off
  • Annual professional development stipend

Parsley Health is committed to providing an equitable, fair and transparent compensation program for all employees.

The starting salary for this role is between $167,750 - $195,000, depending on skills and experience. We take a geo-neutral approach to compensation within the US, meaning that we pay based on job function and level, not location.

Individual compensation decisions are based on a number of factors, including experience level, skillset, and balancing internal equity relative to peers at the company. We expect the majority of the candidates who are offered roles at our company to fall healthily throughout the range based on these factors. We recognize that the person we hire may be less experienced (or more senior) than this job description as posted. If that ends up being the case, the updated salary range will be communicated with candidates during the process.


At Parsley Health we believe in celebrating everything that makes us human and are proud to be an equal opportunity workplace. We embrace diversity and are committed to building a team that represents a variety of backgrounds, perspectives, and skills. We believe that the more inclusive we are, the better we can serve our members. 


Important note:

In light of recent increase in hiring scams, if you're selected to move onto the next phase of our hiring process, a member of our Talent Acquisition team will reach out to you directly from an@parsleyhealth.comemail address to guide you through our interview process. 

    Please note: 

  • We will never communicate with you via Microsoft Teams
  • We will never ask for your bank account information at any point during the recruitment process, nor will we send you a check (electronic or physical) to purchase home office equipment

We look forward to connecting!

#LI-Remote

See more jobs at Parsley Health

Apply for this job

+30d

Sr./Staff/Principal Software Engineer [Frontend/Full Stack]

VoltaiqRemote
agileBachelor's degreeremote-firstterraformfigmasqlRabbitMQDesignansibleazuregraphqlgitc++dockerpostgresqltypescriptcsslinuxjenkinspythonAWSfrontend

Voltaiq is hiring a Remote Sr./Staff/Principal Software Engineer [Frontend/Full Stack]

Location: Remote, US

“The battery is the technology of our time.” -The Economist

Voltaiq is an Enterprise Battery Intelligence (EBI) software company. Our data platform brings unprecedented analytics, visualization, and predictive capabilities to any company with a battery-powered business model. Our customers are world-leading brands — including global automakers (Mercedes, Subaru), household-name tech giants (Google, Meta, Amazon), and major battery producers and their materials suppliers (Albemarle, Sila Nanotechnologies) — depend on Voltaiq software to accelerate product development, optimize performance, ensure safety and reliability, and unlock financial value in their products. Our high-powered team is composed of battery industry veterans, PhD scientists, a highly skilled product and engineering team, and an advisory board of C-level industry execs, all of whom are passionate about enabling the global energy transition. Voltaiq is a USA-based fully-remote company serving customers around the world.

The Role

Voltaiq is seeking an exceptional Frontend/Fullstack Software Engineer to join our team as we build out the future of EBI data visualizations and user experiences. We are open to hiring at the Senior, Staff, or Principal level. You will work with other engineers and product managers to develop next-generation battery analytics software solutions to serve some of the world's biggest companies in automotive, consumer electronics, and battery manufacturing.

Responsibilities:

  • Design and develop web applications using Plotly, React, Django, and GraphQL
  • Work with engineering leadership to shape future architectural decisions of Voltaiq’s Frontend Products, mentor team-mates, champion development best practices and keep abreast of new front-end technologies
  • Work closely with the Product Management and Design functions, along with other engineers to understand requirements and design performant solutions
  • Write clean, maintainable, and efficient code that meets business and technical requirements
  • Perform unit testing and integration testing of developed code
  • Own feature development from technical requirements gathering to deployment in production
  • Participate in code reviews and provide feedback to other engineers
  • Troubleshoot and debug issues in production and staging environments

Required Skills & Qualifications:

  • 3+ years of experience in developing web applications using React, Python, and GraphQL
  • 2+ years of data visualization experience with tools like Plotly.js, D3.js, or similar
  • Deep experience with frontend technologies such as HTML, CSS, TypeScript, and Jest
  • Experience with relational database technologies like SQL
  • Experience with containerization technologies like Docker
  • Experience with agile software development methodologies
  • Experience with Git or similar Version Control Systems
  • Strong communication and collaboration skills
  • Strong problem-solving and analytical skills
  • Highly-developed attention to detail, with a drive to deliver intuitive and beautiful solutions to complex analytical workflows
  • Comfortable working in a linux environment
  • Bachelor's degree in Computer Science, Engineering or a related field or comparable experience
  • A passion for working to help accelerate the global transition to sustainable energy
  • Experience in the battery industry is a plus

Bonus Qualifications

  • Experience with React Relay
  • Experience developing from Figma or similar design tools
  • Experience with Django
  • Experience with numpy and pandas

Our Stack

We deploy on AWS, Google Cloud, and Azure by leveraging Terraform and Ansible to build and maintain our infrastructure as code. We use Jenkins to automate our build, test and deploy pipelines continuously. We monitor and gain insights into our systems using Telegraf, InfluxDB, Grafana and Loggly. Our languages and notable frameworks and libraries include Python, Typescript, Django, Graphene, React, and Plotly.js. We use Celery, RabbitMQ, Spark and Redis for asynchronous data processing and scheduled tasks. For persistence we use PostgreSQL and the Linux filesystem.

Voltaiq is a remote-first company, and salaries are adjusted for cost of labor in each city. The salary range for this position is $120,000 - $180,000 + equity, depending on location and experience. 

Voltaiq is an equal opportunity employer and is committed to achieving a diverse workforce through application of its equal opportunity and nondiscrimination policy, in all aspects of employment.

 

See more jobs at Voltaiq

Apply for this job

+30d

Mobile Platform Architect

Stitch FixRemote, USA
agileremote-firstkotlinDesignswiftmobileslackgraphqluiiosandroid

Stitch Fix is hiring a Remote Mobile Platform Architect

Stitch Fix’s Client Experience Platform team is looking for an experienced Mobile Platform Architect to identify, prioritize, and deliver high value technical investments that enable engineers on our teams to build the next generation of systems that our business is built off of. We trust you to focus your time and efforts where they are needed most. Your commitment to applying technology to business challenges in clean & innovative ways will make you a trusted advisor to your partners and their teams. You will own projects and influence our direction.

You'll help evolve our approach to technical and operational excellence. This will include things like architecture reviews, systems design, incident management, and observability.  You will also define processes, frameworks and strategies for building systems to help our mid-career engineers develop into senior engineers. And you’ll also help develop our mobile strategy and advocate for mobile-specific concerns in the wider organization, building strong cross-functional relationships with partners at many levels.

This is a remote position available within the United States. We operate in an agile-inspired manner; collaborating across multiple time zones. We build modern software with modern techniques for continuous delivery, and service-oriented architecture. We focus on high-value products that solve clearly identified problems but are designed in a sustainable way and deliver long-term value. 

You won't do these things alone. You'll work with engineers across our entire team as well as product, security, and business partners. The position reports to our Director of Platform Engineering.

About the Technology

Technologies we rely on today to create great experiences for our clients include:

  • Swift
  • iOS
  • GraphQL
  • SwiftUI and UIKit
  • Combine
  • Swift Concurrency
  • Unit & UI Testing

Even if you already have experience with these tools, you'll have the chance to get even better with them. And if you don't already use these tools, we will help you learn and become effective with them.

 

You’re excited about this opportunity because...

  • We collaborate as a distributed team using tools like GitHub, Slack, and video conferencing.
  • As a platform team, we impact client and developer experiences through a range of technical projects, from enhancing performance and accessibility to optimizing CI and architecture.
  • Our workflow emphasizes testing and CI for reliable software, utilizing CircleCI for seamless integration.
  • You will work with business partners to help set priorities and plan the roadmap for your team.
  • You will find, hire, and develop people that complement each other as a diverse, inclusive team.
  • You will facilitate technical design discussions, remove blockers and align stakeholders.
  • You will inspire an atmosphere of continuous improvement by serving as a coach, mentor, and technical advisor.
  • You're thrilled to be part of a company that has a proven track record of leveraging big data and driving AI-powered consumer experiences, setting us apart as a leader in the industry.
  • You're eager to contribute to the continuous innovation and growth of our business by working with cutting-edge technologies and modern software development practices.
  • You're excited about the collaborative and inclusive culture at Stitch Fix, where diverse perspectives are valued, and ideas are encouraged to flourish.
  • You're passionate about making a positive impact on our clients' lives, helping them look and feel great through our personalized and data-driven approach to styling.
  • You're motivated by the opportunity to work with a team of talented individuals who are passionate about their craft and share a common goal of delivering high-quality solutions.
  • You're drawn to the dynamic and fast-paced nature of our industry, where we're constantly pushing boundaries and challenging traditional approaches.
  •  

We are excited about you because...

  • You have 6+ years of mobile architecture experience 
  • You have 10+ years of of software development experience 
  • You drive challenging and complex cross-functional problems to resolution. 
  • You thoughtfully approach solutions and recognize the importance of buy-in, feedback, and teamwork 
  • You easily build trust and rapport with everyone 
  • You thrive as a technical representative for Mobile Platforms
  • You are enthusiastic about technology
  • You enjoy building solutions that contribute to design and architecture across multiple systems 
  • You care deeply about the experience you are delivering
  • You have a platform-focused mindset 
  • You can clearly articulate future architecture vision and prioritize better solutions over perfection
  • You love helping engineers grow 
  • You constantly learn from and teach the people you work with 
  • You've demonstrated your ability to help engineers grow into senior technical leaders.
  • You have deep respect for your craft
  • You continually seek improved software architecture and enthusiastically share your findings with the team
  • You have extensive hands-on experience designing and architecting Native iOS and Native Android applications, with a deep understanding of their ecosystems
  • You are proficient in mobile development languages such as Swift and Kotlin, as well as a strong understanding of mobile app architecture patterns (e.g., MVC, MVVM, TCA).

YOU'LL LOVE WORKING AT STITCH FIX BECAUSE WE

  • Are a successful, vibrant, and transformational company.
  • Are a technology and data-driven business.
  • Are at the forefront of tech and fashion, redefining shopping for the next generation.
  • Are passionate about our clients and live/breathe the client experience.
  • Get to be creative every day.
  • Have a smart, experienced, and diverse leadership team that wants to do it right & is open to new ideas.
  • Believe in autonomy and taking initiative.
  • Embody a remote-first culture.
  • Offer transparent, equitable, and competitive compensation based on your level to help eliminate bias in salaries, as well as equity and comprehensive health benefits.
  • Are serious about our commitment to life-work balance, and have generous parental leave policies.

ABOUT STITCH FIX

We're changing the industry and bringing personal styling to everybody. We believe in a service and a workplace where you can show up as your best, most authentic self. The Stitch Fix experience is not merely curated—it’s truly personalized to each client we style. We are changing the way people find what they love. We’re disrupting the future of retail with the precision of data science by combining it with human instinct to find pieces that fit our client’s unique style. This novel juxtaposition attracts a highly diverse group of talented people who are both thinkers and doers. This results in a simple, yet powerful offering to our customers and a successful, growing business serving millions of men, women and kids throughout the US and UK. We believe we are only scratching the surface and are looking for incredible people like you to help us boldly create our future. 

 

Compensation and Benefits

Our anticipated compensation reflects the cost of labor across several US geographic markets, and the range below indicates the low end of the lowest-compensated market to the high end of the highest-compensated market. This position is eligible for new hire and ongoing grants of restricted stock units depending on employee and company performance. In addition, the position is eligible for medical, dental, vision, and other benefits. Applicants should apply via our internal or external careers site.
Salary Range
$254,000$270,000 USD

This link leads to the machine readable files that are made available in response to the federal Transparency in Coverage Rule and includes negotiated service rates and out-of-network allowed amounts between health plans and healthcare providers. The machine-readable files are formatted to allow researchers, regulators, and application developers to more easily access and analyze data.

Please review Stitch Fix's US Applicant Privacy Policy and Notice at Collection here: https://stitchfix.com/careers/workforce-applicant-privacy-policy

Recruiting Fraud Alert: 

To all candidates: your personal information and online safety are top of mind for us.  At Stitch Fix, recruiters only direct candidates to apply through our official career pages at https://www.stitchfix.com/careers/jobs or https://web.fountain.com/c/stitch-fix.

Recruiters will never request payments, ask for financial account information or sensitive information like social security numbers. If you are unsure if a message is from Stitch Fix, please email RecruitingOperations@stitchfix.com

You can read more about Recruiting Scam Awareness on our FAQ page here: https://support.stitchfix.com/hc/en-us/articles/1500007169402-Recruiting-Scam-Awareness 

 

See more jobs at Stitch Fix

Apply for this job

+30d

Technical Careers Talent Community

Stitch FixRemote, USA
sqlDesigngraphqlUXqarubydockerpythonAWS

Stitch Fix is hiring a Remote Technical Careers Talent Community

Not seeing an open job currently that matches your skills and experience?JOIN the Talent Community!

At Stitch Fix, we’re passionate about people and know that finding a career that’s right for you can take time and patience. That’s why we built this technical talent community – to support you in “finding a career that looks good on you.” This community is designed to keep you in the loop regarding all things Stitch Fix, including career opportunities, business updates, employee testimonials, a peek inside our culture and so much more! The technical talent community here at Stitch Fix focuses on roles and news in Engineering, Algorithms, Product, and IT.  

Our tech stack includes: ETL, Python, SQL, Spark, Stats, ML Frameworks, ML Systems, Ruby, GoLang, React, GraphQL, Kafka, AWS, CI, and Docker. 

To join the community, tell us a little about yourself by answering a few questions below. We hope you’re just as excited to learn more about our amazing culture as we are to share it with you!

*Please note: This is not a job application. Should you have interest in joining our Tech team, a formal application will be required to move forward with your candidacy.

 

This link leads to the machine readable files that are made available in response to the federal Transparency in Coverage Rule and includes negotiated service rates and out-of-network allowed amounts between health plans and healthcare providers. The machine-readable files are formatted to allow researchers, regulators, and application developers to more easily access and analyze data.

Please review Stitch Fix's US Applicant Privacy Policy and Notice at Collection here: https://stitchfix.com/careers/workforce-applicant-privacy-policy

Recruiting Fraud Alert: 

To all candidates: your personal information and online safety are top of mind for us.  At Stitch Fix, recruiters only direct candidates to apply through our official career pages at https://www.stitchfix.com/careers/jobs or https://web.fountain.com/c/stitch-fix.

Recruiters will never request payments, ask for financial account information or sensitive information like social security numbers. If you are unsure if a message is from Stitch Fix, please email RecruitingOperations@stitchfix.com

You can read more about Recruiting Scam Awareness on our FAQ page here: https://support.stitchfix.com/hc/en-us/articles/1500007169402-Recruiting-Scam-Awareness 

 

See more jobs at Stitch Fix

Apply for this job

+30d

Senior Full Stack Software Engineer

Culture BiosciencesRemote - United States
DesigngraphqltypescriptpythonAWS

Culture Biosciences is hiring a Remote Senior Full Stack Software Engineer

About Us

Culture’s mission is to simplify bioprocess development and make it as fast and easy to scale bioprocesses, as it is to scale software. With this mission, Culture’s first offering enables biopharma, biotechnology, and synthetic biology companies to execute their bioprocessing R&D in the cloud. Our clients design, manage, and analyze bioprocess experiments in Culture’s Console web application. Culture’s offering enables customers to focus on designing and improving their processes versus spending time and effort building out their own high-throughput process development laboratories. Customers remotely observe their processes and analyze data while their experiments are executed in Culture’s cloud bioreactor facility in South San Francisco. The facility is enabled by Culture’s proprietary 250mL and 5L single-use bioreactor technology and software systems.

At Culture, we combine our passions for biomanufacturing, engineering, and operations to build new solutions that make bioprocess development faster. We value curiosity, communication, collaboration, a customer-focused mindset and a drive for results.

The Role

We are looking for an experienced full stack software engineer and technical leader who wants to build the software platform that will transform biomanufacturing. You will collaborate with electrical, mechanical, biological, and chemical engineers to build our core technology. Your work will quickly impact cutting edge biotechnology companies by helping them get their products to market faster and more efficiently.

Our software challenges are more than scaling a web platform: we model biological processes and operate mission-critical software within bioreactors.

You will work with our software, hardware and product teams to design and build both internal and customer facing software tools. These tools will help us run our bioreactors more efficiently, ensure generation of high quality data, and ultimately move the needle on the biotech revolution.

What you'll do

As a Senior Software Engineer at Culture Biosciences, you will be at the heart of our engineering process, building software that empowers our company to deliver best-in-class products and services. Your role will be pivotal in steering the technical direction of our team and laying down the foundation of our products. Here's how you'll contribute:

  • Design, plan and lead complex technical projects that require collaboration across various teams within the company.
  • Own the initiative to recognize and shape cross-team plans for addressing and reducing critical technical debt.
  • Coordinate inter-team efforts to unify product improvement, innovation, and quality assurance.
  • Guide and mentor the software team through active participation in technical discussions and decision-making processes. Assist in assessing the tradeoffs of technical choices to ensure they meet our strategic objectives and user requirements.
  • Continuously improve individual, team, and inter-team efficiency, productivity and developer experience.
  • Work closely with product managers, designers, and cross-functional engineering teams to understand user needs and translate them into system requirements and features.

About you

You are a seasoned software engineer who enjoys the challenge of building complex systems and is comfortable across the full technology stack. You bring a strategic approach to software development, with a keen eye for detail and a commitment to excellence. Here’s what we expect:

  • 8-10 years of professional experience in software engineering, including a previous role as a technical lead
  • Possess the leadership skills required to guide and influence the team, providing technical direction and mentorship
  • Strong understanding of system design and architecture, with the ability to architect scalable, reliable, and performant software solutions
  • Expertise in a significant portion of our technology stack, including Python, TypeScript, React, GraphQL, and AWS
  • Versed in deploying and managing applications on AWS, with hands-on experience in automated CI/CD, containerization technologies, and infrastructure as code
  • Passionate about up-leveling yourself and those around you through curiosity, mentorship, and fostering a collaborative and inclusive team environment
  • Strong communicator interested in working on a multidisciplinary team
  • Strong interest in biotechnology is a plus

In return, we offer a supportive environment. Our company values are:

  • Lift others up. Because we all do better when we help each other succeed.
  • Commitment to reliability. Our teammates and customers are counting on us.
  • Think like an owner.Progress is driven by teams who care.
  • Try new things.Big innovations start with small ideas and actions

Location & Schedule

  • This is a remote or hybrid position based in the United States. 

Base Salary Range

  • Culture Biosciences's compensation package includes market competitive salary, equity for all full time roles, and great benefits. Our expected cash compensation for this role is $180,000 - $205,000. We are hiring for multiple levels and backgrounds so final offers may vary within the range provided based on experience, expertise, and other factors.

Benefits

  • Competitive salary and equity compensation
  • Medical, Dental, Vision, and Life insurance
  • Medical and Dependent Care FSA (prorated based on start-date)
  • 401(k) plan with company match
  • Unlimited responsible time off policy
  • 12 weeks of parental leave at full salary

Culture Biosciences provides equal employment opportunities to all employees and applicants. We seek to build a company that promotes inclusion and expands the diversity of our industry as a whole. We encourage people with identities underrepresented in biotech and technology to apply.

See more jobs at Culture Biosciences

Apply for this job

+30d

Staff Software Engineer (Full Stack Javascript)

VestwellNew York, NY(Open to Remote)
agilesqlDesigngraphqlapic++dockertypescriptjenkinsAWSjavascriptreactjsbackendfrontend

Vestwell is hiring a Remote Staff Software Engineer (Full Stack Javascript)

Who Are We?

There are over 30M small businesses in the United States, but only a tiny fraction of them have a workplace savings program in place.  As the savings gap in the country widens, it’s imperative that every worker has access to and participates in their company’s savings program, such as a 401(k) or 403(b).  We believe that American workers should have easy access to an inexpensive, flexible, and intuitive solution to save for a brighter future. 

Unfortunately, prior to Vestwell, small businesses have been neglected and underserved, with expensive, inflexible, poorly designed offerings built on old, mainframe software.  Vestwell is changing that, starting with rebuilding the core infrastructure for the modern era.  

Vestwell’s north star is to be the engine behind a $30T industry, powering all payroll-deducted workplace savings programs for small-to-midsize businesses, such as 401(k), 403(b), IRA, emergency savings accounts (ESA), health savings accounts (HSA), 529 college savings, and alike.  

Vestwell’s focus is to build the most flexible, powerful workplace savings and investment platform, delivered through the hands and minds of their financial services partners with the help of payroll provider partners. The team at Vestwell makes the hard stuff look easy, by combining the expertise of financial advice with the sophistication of a technology provider.

As a result, workplace providers are able to bestow the advice and solution employers and employees have been asking for, while growing and scaling along the way. Employers get a cost-effective solution designed for their needs without all the headaches, and employees get a user-friendly portal that helps them achieve their long-term saving goals. 

Why Vestwell?

With backing from leading FinTech investors, as well as a growing team of dedicated professionals of strong industry pedigree, Vestwell is at the forefront of a much-needed change in a 40-year old industry. Our team believes in the mission we’ve set out to achieve and we are working hard to get there. We’re ambitious, honest, thoughtful, and fun.

Who are we looking for?

The Engineering team is looking for an experienced Full Stack Javascript Engineer to join our growing team. You're a great fit for this role if you have extensive knowledge of the Javascript ecosystem and want to help us build and maintain modern software solutions in an antiquated financial industry.

You have a strong ability to balance detail-oriented tasks with long term strategy, are adaptable and willing to take ownership over a vertical slice of a product. You have great communication skills that empowers you to collaborate cross-functionally with non-technical operational teams and are able to understand and solve their problems. You value the importance of data integrity when working with highly regulated and secure products.

Requirements

The Necessities

  • Extensive professional frontend and backend Javascript and Typescript experience in an Agile organization
  • Experience with JSX/TSX (ReactJS) and thorough understanding of functional components, hooks and commonly used libraries like React Query and Material UI.
  • Experience with Nest.js
  • Ability to develop, maintain, and support automation test suites
  • Professional experience with SQL-based databases
  • Experience designing, building, and consuming RESTful APIs
  • Ability to collaborate effectively with product managers, engineers and non-technical stakeholders 
  • Have worked with and/or managed remote Engineers

The Extras

  • Professional experience with GraphQL
  • Microservice architecture experience using Docker
  • DevOps or SysOps experience
  • Familiarity with AWS
  • An understanding of SRE best practices, such as postmortems, logging, alerting, and toil reduction
  • Experience with CI/CD and automation pipelines using Jenkins
  • Proven ability to mentor less experienced developers

Day to day, you may additionally…

  • Partner with, understand problems of, and create solutions for business operations teams
  • Collaborate closely with other Engineers and the rest of the Vestwell team to determine architecture for upcoming projects
  • Work with both engineering and product teams to drive solution design
  • Create complex logical frameworks, workflows, RESTful API endpoints, and JSON formats to exchange key data with the rest of the platform
  • Help plan, automate, and scale our infrastructure

Our Culture

We aim to follow Agile best practices with a focus on empowering full stack development teams so that they can own a vertical slice of the product, and are empowered to make decisions and create a roadmap for a section of the product and business.

We want squads to be first class citizens, working as a team to define their roadmap and prioritization, that follows best practices in development, automation testing, deploying, and support.

The expected salary range for this position is $160K - $180K with a bonus variable. Please note that salary bands are based on NY and other similar metro areas and may differ based on where the role is ultimately hired.

For your awareness you will only receive correspondence from recruiting@vestwell.com any other domain not ending in Vestwell.com is not our Recruitment team.

Vestwell’s Privacy Policy. Attention California residents: In the course of conducting our business and complying with federal, state, and local government regulations governing such matters as employment, tax, insurance, etc., we must collect Personal Information from you. Should you accept employment with Vestwell you may view our California Privacy Rights Act here: Vestwell’s California Privacy Rights Policy.

Our Benefits

We’re a growth stage startup with lots of exciting milestones ahead. We value health and wellness at Vestwell and in addition to a dedicated Employee Wellbeing Committee, we offer competitive health coverage and an open vacation policy. We have adopted a remote-hybrid office policy, but all employees are welcome at our bright, comfortable office with many workspace options in midtown Manhattan so everyone has a setting that is the most productive for them. We provide our team with all the equipment they need (plus a few perks!) to work effectively remotely. Oh, and naturally we have a great 401(k) plan!

Apply for this job

+30d

Database Administrator II

ClassySan Diego, Remote
nosqlsalesforceDynamicsDesignmongodbgraphqlc++mysqllinuxpythonAWSjavascriptNode.js

Classy is hiring a Remote Database Administrator II

Classy, an affiliate of GoFundMe, is a Public Benefit Corporation and giving platform that enables nonprofits to connect supporters with the causes they care about. Classy's platform provides powerful and intuitive fundraising tools to convert and retain donors. Since 2011, Classy has helped nonprofits mobilize and empower the world for good by helping them raise over $6 billion. Classy also hosts the Collaborative conference and the Classy Awards to spotlight the innovative work nonprofits are implementing around the globe. For more information, visitwww.classy.org.

About the role:

Classy's Product Technology team is hiring a Database Administrator II to help design, build, and maintain our data services and infrastructure that drive vast volumes of financial transactions measured in millions. The ideal candidate will combine solid engineering expertise with product aptitude, driven by exciting technical challenges that come with scale, and thrive in a fast-paced, iterative, and collaborative environment. We want to talk to you if you are unfazed by the idea of optimizing and extending existing systems to make them more robust, maintainable, and scalable. 

 

What you’ll accomplish:

  • Have a critical role in maintaining robust, fault-tolerant, data integration service layers.
  • Assist Software Engineers in implementing and delivering new features leading to higher adoption of fundraising tools on the platform.
  • Build reporting and monitoring tools to ensure the stability and security of the system.
  • Develop on our highly scalable data platforms that include Aurora (MySQL), Atlas (MongoDB), Redshift and Redis.
  • Investigate and troubleshoot data processing bottlenecks to determine courses of action that predicate microservice design
  • Help develop best practices data management processes with an eye on distributed database architectures and resiliency.
  • Participate in an engineering culture of “always be learning” where the sharing and learning from failures is celebrated and the giving and receiving of constructive candid feedback is highly encouraged.
  • Maintaining existing databases with upgrades, scheduled jobs, backup/restores and security.

 

What you bring (Required):

  • Bachelor’s Degree in Computer Science or a related field, or equivalent work experience.
  • 2+ years maintaining highly scalable projects involving cloud-based infrastructures.
  • Excellent understanding of distributed data models with experience debugging distributed databases with high data loads.
  • Strong experience writing performant SQL/MQL queries for relational and non-relational databases with the ability to know what the impact of complex queries entail.
  • Proficient with programming and scripting (for example, Python, Linux Shell, Javascript ES6, Node.js, AWS (Lambda, SNS, EC2, ECS)), with the ability to read and understand existing source code in order to analyze performance and recommend improvements.
  • Experience with APM tools such as NewRelic or DataDog, and how to use those tools to troubleshoot performance issues.
  • Experience with Scrum/Agile development methodologies.
  • Proficiency in schema design in relational and NoSQL databases (MySQL, MongoDB).
  • A deep sense of quality, and sharp engineering skills with strong computer science fundamentals.
  • Experience with multi-regional cloud computing database infrastructure

What would be awesome to have (Preferred):

  • Knowledge of CRM data architecture, such as Salesforce (SFDC) or Microsoft (Dynamics 365) 
  • Experience with cached data store or search technology for fast runtime access (OpenSearch, GraphQL, Splunk, Solr, Algolia)
  • Comfortable with working on loosely coupled microservices.
  • Experience with code versioning tools (GIT/Bitbucket).
  • Experience supporting Big Data solutions

Why you’ll love it here: 

  • Market competitive pay
  • Rich healthcare benefits, including employer paid premiums for medical/dental/vision (100% for employee only plans and 85% for employee + dependent plans) and employer HSA contributions. 
  • 401(k) retirement plan with company matching
  • Hybrid workplace with fully remote flexibility for many roles
  • Monetary support for new hire setup, hybrid work & wellbeing, family planning, and commuting expenses
  • A variety of mental and wellness programs to support employees   
  • Generous paid parental leave and family planning stipend
  • Supportive time off policies including vacation, sick/mental health days, volunteer days, company holidays, and a floating holiday
  • Learning & development and recognition programs
  • Gives Back Program where employees can nominate a fundraiser every month for a donation from the company
  • Inclusion, diversity, equity, and belonging are vital to our priorities and we continue to evolve our strategy to ensure DEI is embedded in all processes and programs at GoFundMe. Our Diversity, Equity, and Inclusion team is always finding new ways for our company to uphold and represent the experiences of all of the people in our organization.
  • Employee resource groups
  • Your work has a real purpose and will help change lives on a global scale.
  • You’ll be a part of a fun, supportive team that works hard and celebrates accomplishments together. 
  • We live by our core values: impatient to be great, find a way, earn trust every day, fueled by purpose
  • We are a certified Great Place to Work, are growing fast and have incredible opportunities ahead!
  • Our commitment to Sustainability.Classy exists to create a sustainable world for all. 

 

Dedication to Diversity 

Classy is working toward building a more diverse and inclusive environment that is representative of individuals of all backgrounds, experiences, and lifestyles, allowing all employees to feel comfortable being their true, authentic selves in a space that enables productivity and meaningful work.

 

The total annual salary for this full-time position is $86,500 - $116,500 + equity + benefits.  As this is a remote position, the salary range was determined by role, level, and possible location across the US. Individual pay is determined by work location and additional factors including job-related skills, experience, and relevant education or training. 

Your recruiter can share more about the specific salary range based on your location during the hiring process. 

 

If you require a reasonable accommodation to complete a job application or a job interview or to otherwise participate in the hiring process, please contact us at accommodationrequests@gofundme.com

 

See more jobs at Classy

Apply for this job

+30d

Senior Software Engineer (Frontend)

ClassyRemote, US
agileDesignmongodbgraphqlscrumUXc++dockerelasticsearchmysqltypescriptlinuxAWSjavascriptfrontendNode.jsPHP

Classy is hiring a Remote Senior Software Engineer (Frontend)

Classy, an affiliate of GoFundMe, is a Public Benefit Corporation and giving platform that enables nonprofits to connect supporters with the causes they care about. Classy's platform provides powerful and intuitive fundraising tools to convert and retain donors. Since 2011, Classy has helped nonprofits mobilize and empower the world for good by helping them raise over $6 billion. Classy also hosts the Collaborative conference and the Classy Awards to spotlight the innovative work nonprofits are implementing around the globe. For more information, visitwww.classy.org.

About the role:

Classy's Product Technology team is hiring a Senior Front-End Software Engineer to build and extend our visualization tools, component library, and new experiences for the next phase of our business. The ideal candidate is highly skilled in front end web development using React and TypeScript, as well as building and maintaining a component library. We want to talk to you if you can see beyond the {brackets} and love transforming designs and mockups into highly-scalable, fault-tolerant, and seamless user experiences. 

What you’ll do:

  • Analyze, design, and develop software that delivers clean, maintainable code within a large, complex, and established code base.
  • Contribute to the Classy component library to be consumed throughout the organization for new and existing user experiences.
  • Learn and grow your skills by working collaboratively with experienced and engaged developers to design new features and re-architect existing ones.
  • Within an Agile environment, work as part of a Scrum team and develop web-based software solutions.
  • Mentor engineers to become proficient developers using best software development practices and processes.

What you bring (Required):

  • Bachelor’s Degree in Computer Science or a related field, or equivalent work experience.
  • 4+ years of professional software development experience with relevant web development technologies
  • Passion for UX and design, specifically building and maintaining a component library
  • Excellent understanding of distributed software architecture with experience debugging distributed systems with high data loads.
  • High-level proficiency with Javascript ES6, TypeScript & React.
  • Ability to understand product requirements and translate them into technical subtasks.
  • Experience with Scrum/Agile development methodologies.
  • Deep experience with code versioning tools (GIT/Bitbucket).
  • A deep sense of quality, and sharp engineering skills with strong computer science fundamentals.
  • Experience working with remote and offshore teams

What would be awesome to have (Preferred):

  • Experience building PCI compliant systems
  • Experience with simultaneously managing multiple web application frameworks and/or migrating from one framework to another. 
  • Experience working with MySQL, MongoDB, Node.js, PHP, Linux, & Next.js
  • Experience working with Microservice architecture and Micro Frontends
  • Familiarity with GraphQL, Elasticsearch, Docker, AWS (EC2, ECS, Lambda, SNS).
  • Familiarity with Storybook 

Why you’ll love it here: 

  • Market competitive pay
  • Rich healthcare benefits, including employer paid premiums for medical/dental/vision (100% for employee only plans and 85% for employee + dependent plans) and employer HSA contributions. 
  • 401(k) retirement plan with company matching
  • Hybrid workplace with fully remote flexibility for many roles
  • Monetary support for new hire setup, hybrid work & wellbeing, family planning, and commuting expenses
  • A variety of mental and wellness programs to support employees   
  • Generous paid parental leave and family planning stipend
  • Supportive time off policies including vacation, sick/mental health days, volunteer days, company holidays, and a floating holiday
  • Learning & development and recognition programs
  • Gives Back Program where employees can nominate a fundraiser every month for a donation from the company
  • Inclusion, diversity, equity, and belonging are vital to our priorities and we continue to evolve our strategy to ensure DEI is embedded in all processes and programs at GoFundMe. Our Diversity, Equity, and Inclusion team is always finding new ways for our company to uphold and represent the experiences of all of the people in our organization.
  • Employee resource groups
  • Your work has a real purpose and will help change lives on a global scale.
  • You’ll be a part of a fun, supportive team that works hard and celebrates accomplishments together. 
  • We live by our core values: impatient to be great, find a way, earn trust every day, fueled by purpose
  • We are a certified Great Place to Work, are growing fast and have incredible opportunities ahead!
  • Our commitment to Sustainability.Classy exists to create a sustainable world for all. 

Dedication to Diversity 

Classy is working toward building a more diverse and inclusive environment that is representative of individuals of all backgrounds, experiences, and lifestyles, allowing all employees to feel comfortable being their true, authentic selves in a space that enables productivity and meaningful work.

The total annual salary for this full-time position is $130,000- $175,000 + equity + benefits.  As this is a remote position, the salary range was determined by role, level, and possible location across the US. Individual pay is determined by work location and additional factors including job-related skills, experience, and relevant education or training. 

Your recruiter can share more about the specific salary range based on your location during the hiring process. 

If you require a reasonable accommodation to complete a job application or a job interview or to otherwise participate in the hiring process, please contact us at accommodationrequests@gofundme.com



See more jobs at Classy

Apply for this job

+30d

Staff Fullstack Engineer

Lumos IdentityRemote
Designmongodbslackgraphqlc++typescriptpythonbackendfrontend

Lumos Identity is hiring a Remote Staff Fullstack Engineer

???? The Lumos Story

Apple changed the world with the App Store by making all kinds of consumer tech a click away. Lumos is doing that, but for all the apps a company uses. In short, we are building a company’s AppHQ to manage all apps in one place.

Here’s how it works: You go to the Lumos AppStore, request your app of choice, your manager approves the request in Slack and your account is created — instantly. No long IT ticket queues anymore. What if you stop using the app? Lumos automatically detects that and removes your license, saving the company money and improving security. In its essence, Lumos is creating the meta app for all apps.

???? Why You Should Join Lumos

  • ???? Jump on a Rocketship: In less than two years, our team has grown from 20 to ~80 people and our customer base has 10x’ed with companies like GitHub, MongoDB and Major League Baseball!
  • ???? Trust Renowned Backers: Andreessen Horowitz (a16z) backed us since the beginning. Also, Prospect (a platform where startup people evaluate different companies) called Lumos a 10x company among just a few other companies, beating startups like Rippling, Retool or Zapier.
  • ⭐ Thrive in a Unique Culture: You’ll be one of the first 100 people to join. So, you'll have actual influence on the trajectory of the company. Most importantly, when we talk about Lumos, we don’t just talk about the products we create but also the distinctive philosophy we live by. Check out our values to see if it’s a fit.

???? More Information on the Role

We’re seeing very strong adoption with core products, and in order to double down our investment and support accelerating growth, we’re hiring a Staff Fullstack Engineer to lead the team. You'll help set the technical direction of the engineering organization, in addition to building and owning core product features. You will work across the stack, focusing on areas you are most excited about and that bring value to customers. Beyond your technical work, you will gain leadership opportunities early on as we grow our engineering team. You'll be involved in scaling the product, the team, and the entire company. ????

✨ Your Responsibilities

  • Solve challenging technical problems across the stack to develop critical customer-facing features; includes the frontend (React, Typescript), communication layer (GraphQL, Apollo), and backend (Python, Flask, sqlalchemy).
  • Drive end-to-end development of complex projects with multiple engineers and cross-functional stakeholders. See the feature through to launch and own iterations and followups.
  • Collaborate with others to define a long-term technical vision that incorporates current problems and anticipates future issues. Design and build robust, scalable systems that enable us to scale our platform to 10x the number of users.
  • Be a go-to technical resource for the engineering organization. Uplevel your team by setting technical best practices and mentoring engineers.
  • Become an expert in the Lumos product, working with other stakeholders to refine product requirements and team vision.
  • Grow the engineering team! Interview candidates and refine our recruiting processes as we rapidly grow.

????Pay Range

$200,000 - $240,000. Note that this range is a good faith estimate of likely pay for this role; upon hire, the pay may differ due to skill and/or level of experience.

???? What We Value

We care much more about your motivation and excitement to grow into the role than we care just about your CV. Instead of focusing on what people need to have, we focus on what people need to do. Additionally, we try to find out whether you would be a good fit for Lumos based on our values that define how we achieve outcomes and what characteristics we value.

We strongly encourage individuals from underrepresented groups to apply. ????

???? Benefits and Perks:

  • ???? Remote work culture (+/-4 hours Pacific Time)
  • ⛑ Medical, Vision, & Dental coverage covered by Lumos
  • ???? Company and team bonding trips throughout the year fully covered by Lumos
  • ???? Optimal WFH setup to set you up for success
  • ???? Unlimited PTO, with minimum time off to make sure you are rested and able to be at your best
  • ???????? Up to (4) months off for both the Birthing & Non-birthing parent
  • ???? Wellness stipend to keep you awesome and healthy
  • ???? 401k contribution plan

Thank you for considering us - we're flattered! ???? ????

Apply for this job

+30d

Security Software Engineer Lead

Lumos IdentityRemote
terraformmongodbslackgraphqlc++typescriptpythonAWSbackendfrontend

Lumos Identity is hiring a Remote Security Software Engineer Lead

???? The Lumos Story

Apple changed the world with the App Store by making all kinds of consumer tech a click away. Lumos is doing that, but for all the apps a company uses. In short, we are building a company’s AppHQ to manage all apps in one place.

Here’s how it works: You go to the Lumos AppStore, request your app of choice, your manager approves the request in Slack and your account is created — instantly. No long IT ticket queues anymore. What if you stop using the app? Lumos automatically detects that and removes your license, saving the company money and improving security. In its essence, Lumos is creating the meta app for all apps.

???? Why You Should Join Lumos

  • ???? Jump on a Rocketship: In less than two years, our team has grown from 20 to ~80 people and our customer base has 10x’ed with companies like GitHub, MongoDB and Major League Baseball!
  • ???? Trust Renowned Backers: Andreessen Horowitz (a16z) backed us since the beginning. Also, Prospect (a platform where startup people evaluate different companies) called Lumos a 10x company among just a few other companies, beating startups like Rippling, Retool or Zapier.
  • ⭐ Thrive in a Unique Culture: You’ll be one of the first 100 people to join. So, you'll have actual influence on the trajectory of the company. Most importantly, when we talk about Lumos, we don’t just talk about the products we create but also the distinctive philosophy we live by. Check out our values to see if it’s a fit.

???? More Information on the Role

We’re seeing very strong adoption with core products, and in order to double down our investment and support accelerating growth, we’re hiring a Security Engineer Lead to join the team. You'd be among the first 100 employees and set the foundation for extreme growth. ????

Lumos is transforming how companies operate by building the first AppStore for Companies. As such, Lumos sits in the middle of some of the most sensitive data & control available in enterprises. As the first security software engineer lead at Lumos, you will have a key impact on the definition & growth of our entire security program: from identifying and translating customer needs to defining, architecting, and developing our security infrastructure, application components, and processes.

✨ Your Responsibilities

  • Lead efforts across the broad spectrum of security needs in an early-stage startup. That includes application security, infrastructure security, threat intelligence, incident response, compliance, identity & access management (IAM), and more. You will wear many hats.
  • Solve challenging technical problems across the stack to improve our security posture; may include the frontend (React, Typescript), communication layer (GraphQL), and backend (Python, Terraform, AWS).
  • Build a deep understanding of our customers and Lumos’s technology to satisfy the security needs of a broad range of customers.
  • Collaborate with cross-functional stakeholders in engineering and beyond to identify & mitigate key technical risks & plan for security at scale.
  • Level up the team. You mentor those around you and improve the standards of our engineering organization.

⛰ Your Skills

  • Software engineering. You have hands-on software development experience. You love building great software products that deliver value to customers. You are proficient in designing, building, and delivering modern cloud-based software systems.
  • Proven mentor & team player. You have proven track record of mentoring teammates. You foster a collaborative & inclusive working environment. You have a mature approach to sharing knowledge, training, and developing the skills of your team members. You level up the team, putting the success of their team about their own ego: “we” before “I”.
  • Security expert. You are a security generalist. You are passionate about securing complex systems. You know how to incorporate the needs of our customers into the security roadmap across the pre-sales and post-sales spectrum. Familiarity with a common compliance framework such as SOC2, GDPR, FedRAMP, ISO 27001, etc.) is a plus.

????Pay Range

  • $150,000 - $210,000. Note that this range is a good faith estimate of likely pay for this role; upon hire, the pay may differ due to skill and/or level of experience.

???? What We Value

We care much more about your motivation and excitement to grow into the role than we care just about your CV. Instead of focusing on what people need to have, we focus on what people need to do. Additionally, we try to find out whether you would be a good fit for Lumos based on our values that define how we achieve outcomes and what characteristics we value.

We strongly encourage individuals from underrepresented groups to apply. ????

???? Benefits and Perks:

  • ???? Remote work culture (+/-4 hours Pacific Time)
  • ⛑ Medical, Vision, & Dental coverage covered by Lumos
  • ???? Company and team bonding trips throughout the year fully covered by Lumos
  • ???? Optimal WFH setup to set you up for success
  • ???? Unlimited PTO, with minimum time off to make sure you are rested and able to be at your best
  • ???????? Up to (4) months off for both the Birthing & Non-birthing parent
  • ???? Wellness stipend to keep you awesome and healthy
  • ???? 401k contribution plan

Thank you for considering us - we're flattered! ???? ????

Apply for this job

+30d

Senior Fullstack Engineer

Lumos IdentityRemote
Designmongodbslackgraphqlc++typescriptpythonbackendfrontend

Lumos Identity is hiring a Remote Senior Fullstack Engineer

???? The Lumos Story

Apple changed the world with the App Store by making all kinds of consumer tech a click away. Lumos is doing that, but for all the apps a company uses. In short, we are building a company’s AppHQ to manage all apps in one place.

Here’s how it works: You go to the Lumos AppStore, request your app of choice, your manager approves the request in Slack and your account is created — instantly. No long IT ticket queues anymore. What if you stop using the app? Lumos automatically detects that and removes your license, saving the company money and improving security. In its essence, Lumos is creating the meta app for all apps.

???? Why You Should Join Lumos

  • ???? Jump on a Rocketship: In less than two years, our team has grown from 20 to ~80 people and our customer base has 10x’ed with companies like GitHub, MongoDB and Major League Baseball!
  • ???? Trust Renowned Backers: Andreessen Horowitz (a16z) backed us since the beginning. Also, Prospect (a platform where startup people evaluate different companies) called Lumos a 10x company among just a few other companies, beating startups like Rippling, Retool or Zapier.
  • ⭐ Thrive in a Unique Culture: You’ll be one of the first 100 people to join. So, you'll have actual influence on the trajectory of the company. Most importantly, when we talk about Lumos, we don’t just talk about the products we create but also the distinctive philosophy we live by. Check out our values to see if it’s a fit.

???? More Information on the Role

We’re seeing very strong adoption with core products, and in order to double down our investment and support accelerating growth, we’re hiring a Senior Fullstack Engineer to join the team. You'd be among the first 100 employees and set the foundation for extreme growth. ????

You'll build and own core product features, in addition to helping to ensure the health of our engineering systems. You will work across the stack, focusing on areas you are most excited about and that bring value to customers. Beyond your technical work, you will gain leadership opportunities early on as we grow our engineering team. You'll be involved in scaling the product, the team, and the entire company. ????

✨ Your Responsibilities

  • Solve challenging technical problems across the stack to develop critical customer-facing features; includes the frontend (React, Typescript), communication layer (GraphQL, Apollo), and backend (Python, Flask, sqlalchemy).
  • Drive end-to-end development of complex projects with multiple engineers and cross-functional stakeholders. See the feature through to launch and own iterations and followups.
  • Design and build robust, scalable systems that enable us to scale our platform to 10x the number of users.
  • Uplevel your team by setting technical best practices and mentoring engineers.
  • Become an expert in the Lumos product, working with other stakeholders to refine user requirements and team goals.
  • Grow the engineering team! Interview candidates and refine our recruiting processes as we rapidly grow.

????Pay Range

$150,000 - $210,000. Note that this range is a good faith estimate of likely pay for this role; upon hire, the pay may differ due to skill and/or level of experience.

???? What We Value

We care much more about your motivation and excitement to grow into the role than we care just about your CV. Instead of focusing on what people need to have, we focus on what people need to do. Additionally, we try to find out whether you would be a good fit for Lumos based on our values that define how we achieve outcomes and what characteristics we value.

We strongly encourage individuals from underrepresented groups to apply. ????

???? Benefits and Perks:

  • ???? Remote work culture (+/-4 hours Pacific Time)
  • ⛑ Medical, Vision, & Dental coverage covered by Lumos
  • ???? Company and team bonding trips throughout the year fully covered by Lumos
  • ???? Optimal WFH setup to set you up for success
  • ???? Unlimited PTO, with minimum time off to make sure you are rested and able to be at your best
  • ???????? Up to (4) months off for both the Birthing & Non-birthing parent
  • ???? Wellness stipend to keep you awesome and healthy
  • ???? 401k contribution plan

Thank you for considering us - we're flattered! ???? ????

Apply for this job

+30d

Senior Software Engineer

Bachelor's degreesqlDesignvuegraphqlrubyjavaangularpythonjavascriptfrontend

Strike Social is hiring a Remote Senior Software Engineer

Senior Software Engineer - Strike Social - Career Page
+30d

Senior Python Developer

TwistoRemote job, Remote
postgressqlgraphqlapigitpostgresqlpythonbackendfrontend

Twisto is hiring a Remote Senior Python Developer

Contribute to a technology-driven environment with ample opportunities for learning and growth!!


We are looking for a senior Python developer who will help us improve our risk engine!


TL;DR

  • 34 days of vacation

  • Full-remote or hybrid as you prefer - offices in Prague & Warsaw

  • Development and maintenance of our Risk engine 

  • Work onin-house product - no strict deadlines, no context switching, no stress*

  • Be part of the whole development process

  • Stack - Django, GraphQL, Celery, Postgres


Must have’s:

  • Fluent in Python

  • Experience with API integrations

  • Some web frontend skills

  • Communicative English

—----------------------------------------

What is going on at Twisto right now?

We started in 2013 as the simplest deferred payment solution at online checkout. Today we are a daily payments app, delivering seamless omnichannel daily payments to customers across Europe ????. And you can help on our next journey! We are looking for a new colleague to take a position of Python Developer.


Your future challenges:

Dive into an exciting tech stack that includes Django, GraphQL, Celery, and Postgres, and collaborate with our talented developers to create robust solutions, which is the heart of our business. 


You can also expect:

  • Direct influence on Twisto results -development and technology are the core of the company;
  • Focus on automation and full continuous deployment (around 20 release per day);
  • Great space for personal development???? - within the team we regularly organize lectures on the technologies we are playing with and we also organize public events on backend technologies and architecture;
  • Peace of mind ???? - development in our company has separate offices and enough space for concentrated work;
  • Fully remote ????‍???? ????‍???? or hybrid work model (we have nice offices in Prague Karlín and in Warsaw)????;
  • ⭐️Cash equivalent due to hybrid work;
  • Informal and pleasant atmosphere - we all know each other, we don't tolerate formalities and we also have a pack of dogs???? ;
  • Promoting a healthy lifestyle ???? - we do offer Multisport Card, flexible working hours, health care, drinking and fruit daily???? in the office, team events, 6 weeks of vacation???? and 4 whatever days(aka do what you want) ???? or 5 days of additional paid leave for parents after child birth????, etc.

See more jobs at Twisto

Apply for this job

+30d

Application Developer 1

ExsilioRemote
agilesqlDesignjquerygraphqlscrumc++typescriptcssNode.js

Exsilio is hiring a Remote Application Developer 1

Application Developer 1 - Exsilio Solutions - Career Page

See more jobs at Exsilio

Apply for this job

+30d

Software Engineer, Frontend

agileDesigngraphqluiapiUXjavatypescriptangularjenkinspythonAWSreduxbackendfrontend

Evertz Microsystems Limited is hiring a Remote Software Engineer, Frontend

Software Engineer, Frontend - Evertz Microsystems Limited - Career Page

See more jobs at Evertz Microsystems Limited

Apply for this job

+30d

Backend Developer (Node.js)

Atölye15Remote job, Remote
azuregraphqlgitdockertypescriptAWSjavascriptbackendNode.js

Atölye15 is hiring a Remote Backend Developer (Node.js)

Once you are part of us, you will get to work side by side with highly talented and experienced product developers, get the chance to take part in hugeglobal projects promising international growth, employ the latest and finest technologies, and enjoy the ride with your new close-knit teammates.

Get a clearer idea of how we approach the projects we develop from the podcast here, and if you want to get a better picture of our company culture, we strongly suggest you check out our Instagram profile.

Apply for this job

+30d

JavaScript Developer (React.js)

Atölye15Remote job, Remote
Designgraphqlgittypescriptjavascript

Atölye15 is hiring a Remote JavaScript Developer (React.js)

Once you are part of us, you will get to work side by side with highly talented and experienced product developers, get the chance to take part in huge global projects promising international growth, employ the latest and finest technologies, and enjoy the ride with your new close-knit teammates.

Get a clearer idea of how we approach the projects we develop from the podcast here, and if you want to get a better picture of our company culture, we strongly suggest you check out our Instagram profile.

Apply for this job