Full stack software engineer Remote Jobs

110 Results

3d

Senior Full Stack Engineer

Default PortalLondon, GB Remote
agile5 years of experiencenosqlDesignmongodbjavadockertypescriptAWSjavascriptbackend

Default Portal is hiring a Remote Senior Full Stack Engineer

Senior Full Stack Engineer

Location:Remote – Must be UK based

Work Pattern:Full Time/Permanent

Security Clearance:BPSS

The Company:

At Amber Labs, we are a cutting-edge UK and European technology consultancy that prioritises empowering autonomy, promoting experimentation, and facilitating rapid learning to provide exceptional value to our clients. Our company culture is centred around collaboration, where all colleagues, regardless of their role, work together to minimise risk and shorten delivery times. Our team consists of highly-skilled cross-functional consultants, analysts, and support staff.

The Role:

Are you passionate about cutting-edge technology and eager to join a dynamic team of innovators? We are seeking a Senior Full Stack Engineer to play a pivotal role in developing and enhancing our web applications. If you thrive in a fast-paced environment and possess expertise in JavaScript, TypeScript, Nunjucks, Java 17, Spring Boot, and MongoDB, we want to hear from you!

Key Responsibilities:

  • Design, develop, and maintain scalable and efficient web applications using JavaScript, TypeScript, and Nunjucks.
  • Collaborate with cross-functional teams to translate business requirements into technical solutions.
  • Utilise Java 17 and Spring Boot to develop robust backend services and APIs.
  • Implement data storage solutions using MongoDB, ensuring data integrity and performance.
  • Conduct code reviews, identify areas for improvement, and contribute to the overall technical architecture.

Requirements:

  • Minimum of 5 years of experience in full stack web development.
  • Proficiency in JavaScript and TypeScript, with a strong understanding of modern frameworks such as React or Angular.
  • Experience with Nunjucks or similar templating engines.
  • Solid understanding of Java programming language and Spring Boot framework.
  • Familiarity with MongoDB or other NoSQL databases.
  • Strong problem-solving skills and ability to troubleshoot complex issues.
  • Excellent communication and collaboration skills.

Preferred Qualifications:

  • Experience with cloud technologies such as AWS or Azure.
  • Knowledge of containerisation and orchestration tools like Docker and Kubernetes.
  • Understanding of Agile methodologies and DevOps practices.
  • Contributions to open-source projects or a strong GitHub profile.

Benefits:

  • Join a rapidly expanding startup where personal growth is a part of our DNA.
  • Benefit from a flexible work environment focused on deliverable outcomes.
  • Receive private medical insurance through Aviva.
  • Enjoy the benefits of a company pension plan through Nest.
  • 25 days of annual leave plus UK bank holidays.
  • Access Perkbox, a global employee rewards platform offering discounts, perks, and wellness resources.
  • Participate in a generous employee referral program.
  • A highly collaborative and collegial environment with opportunities for career advancement.
  • Be encouraged to take bold steps and embrace a mindset of experimentation.
  • Choose your preferred device, PC or Mac.

Diversity & Inclusion:

Here at Amber Labs, we are dedicated to fostering an inclusive and equitable workplace for all. Our commitment to diversity, equality, and inclusion includes:

  • Valuing the unique experiences, perspectives, and backgrounds of all employees and creating an environment where everyone feels welcomed, respected, and valued.

  • Prohibiting all forms of harassment, bullying, discrimination, and victimisation and promoting a culture of dignity and respect for all.

  • Educating all new hires on our Diversity and Inclusion policies and ensuring they are aware of their rights and responsibilities to create a safe and inclusive workplace.

  • By taking these steps, we are dedicated to building a workplace that reflects and celebrates the diversity of our employees and communities.

This role at Amber Labs is a permanent position, and all employees are required to meet the Baseline Personnel Security Standard (BPSS). Please be advised that, at this time, we are unable to consider candidates who require sponsorship or hold a visa of any type.

What Happens Next?

Our Talent Acquisition Team will be in touch to advise you on the next steps. We have a two-stage interview process for most of our consultants. In certain cases, we may include a third and final stage, which is a conversation with the company Partners. This will only be considered if deemed necessary.


See more jobs at Default Portal

Apply for this job

5d

Senior Software Engineer - Full-stack

TaniumRemote, Canada
agileBachelor's degreesalesforceDesigngraphqlapigitrubyjavac++jenkinspythonbackendNode.js

Tanium is hiring a Remote Senior Software Engineer - Full-stack

The Basics

As a Senior Software Engineer at Tanium, you will build and maintain best-of-breed products as part of a nimble development team. Tanium focuses on a customer engagement model and feedback process to ensure our products are designed the right way from the beginning. When new products ideas are identified, our software engineers design, develop, test, and deploy the products from the ground up, while iterating with product management and customers for feedback and input.

What you'll do

  • Build and maintain Tanium's products alongside an agile development team
  • Design, develop and test new product ideas from the ground up while working with product management for feedback and input
  • Work on small teams that tackle big challenges in common components like a common data service tasked with unifying and consolidating endpoint data across the entire ecosystem, handling time series data that drive dashboarding and reporting, and exposing data externally through GraphQL enabling partners (like Salesforce) to easily integrate
  • Delivering higher level services enabled by our core services that directly enable our products and focus on everything from security to operations to auditing

 

Education

  • Bachelor's degree or equivalent experience
  • CS Degree preferred

Experience

  • 5+ years industry experience
  • Experience designing and building high-impact, high-performance, scalable, observable, and maintainable backend services and APIs 
  • Knowledge of at least one of Golang (preferred), Node.js, Python, Ruby, Rust, or Java
  • Experience with HTTP API design and development
  • Experience with modern software engineering development and automation tools like git and Jenkins

Other

  • Demonstrates sound judgment for balancing between rapid development, long-term code maintainability and supportability
  • Believes in the power of and the need for writing automated tests as part of development
  • Experienced debugger who can put out fires under pressure when things go wrong in production environments
  • Has knowledge of a variety of modern software frameworks (server side & browser side) and the versatility to learn new tools

About Tanium 

Tanium, the industry’s only provider of converged endpoint management (XEM), leads the paradigm shift in legacy approaches to managing complex security and technology environments. Only Tanium protects every team, endpoint, and workflow from cyber threats by integrating IT, Operations, Security, and Risk into a single platform that delivers comprehensive visibility across devices, a unified set of controls, and a common taxonomy for a single shared purpose: to protect critical information and infrastructure at scale. Tanium has been named to the Forbes Cloud 100 list for six consecutive years and ranks on Fortune’s list of the Best Large Workplaces in Technology. In fact, more than half of the Fortune 100 and the U.S. armed forces trust Tanium to protect people; defend data; secure systems; and see and control every endpoint, team, and workflow everywhere. That’s the power of certainty. Visit www.tanium.com and follow us on LinkedIn and Twitter.

On a mission. Together. 

At Tanium, we are stewards of a culture that emphasizes the importance of collaboration, respect, and diversity. In our pursuit of revolutionizing the way some of the largest enterprises and governments in the world solve their most difficult IT challenges, we are strengthened by our unique perspectives and by our collective actions.   

We are an organization with stakeholders around the world and it’s imperative that the diversity of our customers and communities is reflected internally in our team members. We strive to create a diverse and inclusive environment where everyone feels they have opportunities to succeed and grow because we know that only together can we do great things. 

Each of our team members has 5 days set aside as volunteer time off (VTO) to contribute to the communities they live in and give back to the causes they care about most.   

What you’ll get

The annual base salary range for this full-time position is C$95,000 to C$280,000. This range is an estimate for what Tanium will pay a new hire. The actual annual base salary offered may be adjusted based on a variety of factors, including but not limited to, location, education, skills, training and experience.

 

 

For more information on how Tanium processes your personal data, please see our Privacy Policy.

See more jobs at Tanium

Apply for this job

5d

Full Stack Software Engineer

Agile SixUnited States, Remote
agileDesignapirubyc++javascript

Agile Six is hiring a Remote Full Stack Software Engineer

Agile Six is a people-first, remote-work company that serves shoulder-to-shoulder with federal agencies to find innovative, human-centered solutions. We build better by putting people first. We are animated by our core values of Purpose, Wholeness, Trust, Self-Management and Inclusion. We deliver our solutions in autonomous teams of self-managed professionals (no managers here!) who genuinely care about each other and the work. We know that’s our company’s purpose – and that we can only achieve it by supporting a culture where people feel valued, self-managed, and love to come to work.

The role

Agile Six is looking for a Fullstack Software Engineer with a strong foundation in React.js and Ruby on Rails to join a highly collaborative team working with the Department of Veterans Affairs (VA). Our team is seeking someone interested in and capable of working across the tech stack, using both front and back end languages and frameworks. Our ideal candidate is patient, curious, proactive, and positive; someone who understands the large impact that even small changes can have on end users, someone able to learn a complex landscape and innovate, someone who constantly seizes opportunities to refine, and someone who is dedicated to accessibility and championing the impact our work has on veterans. Most importantly, we are looking for someone with a passion for working on important problems that have a lasting impact on millions of users and make a difference in our government.

Our team partners with the VA to personalize the Veteran experience when logging into VA.gov (user profile within VA.gov), so that Veterans can quickly access and complete tasks related to health care, benefits, and other information most relevant to them. Agile Six embraces open source software and an open ethos regarding software development. We are seeking a candidate who does the same. 

For more context on the project, take a look at the team’s GitHub repository:

Responsibilities

  • Contribute as part of a cross functional Agile team to modernize a large, scalable web application in an open source ecosystem
  • Write components and service APIs using React.js and Ruby on Rails, leveraging software development principles and best practices
  • Build and maintain software with an eye towards modular, extensible, and scalable design
  • Leverage emerging technologies and practices around DevOps, cloud services, AI, automation tools, etc. where appropriate in the course of daily work to improve efficiency and/or quality
  • Demonstrate and model informal leadership qualities, including taking initiative, taking on challenging tasks, supporting other team mates, and in general creating a positive environment for successful delivery
  • Collaborate with other teammates through code reviews, pair coding, mentorship, etc.
  • Demonstrate strong communication and team collaboration skills
  • Write automated unit tests and integration tests, and assist in manual testing as needed
  • As an agile team member, support the team and Product Owner to ensure that work is accurately described and appropriately prioritized, including providing input into user story acceptance criteria and sizing
  • Support the practice of engineering within the larger company as needed through activities such as:
    • Assisting in outreach, recruitment, and hiring efforts
    • Occasionally participating in or otherwise supporting business development efforts, including code or design challenges, writing or reviewing proposal responses, etc.
    • Participating in communities of practice
  • We expect the responsibilities of this position to shift and grow organically over time, in response to considerations such as the unique strengths and interests of the selected candidate and other team members and an evolving understanding of the delivery environment.

Basic qualifications

  • 4+ years of experience as a software engineer
  • 1+ year of production experience with React.js and Ruby on Rails
  • Demonstrated experience maintaining and enhancing applications with modern JavaScript frameworks, a component-based design system, and REST APIs
  • Experience collaborating on modernizing and maintaining a legacy code base
  • Experience working on an Agile team and demonstrating an Agile mindset
  • Experience using automated tests to validate software and build behavior, as well as writing testable code
  • Understanding of common design patterns, software development principles, front-end engineering patterns, and how to apply them
  • Experience working in many different areas of the software stack and solving a variety of engineering problems
  • Ability to work independently on high complexity tasks, and to collaborate as it makes sense for the problem and the work
  • Experience in an open-source, collaborative development environment
  • Has lived and worked in the United States for 3 out of the last 5 years

Additional desired qualifications

  • Familiarity with using CI/CD applications or frameworks to manage code quality assurance and deployment tasks
  • Familiarity with the US Web Design System
  • Familiarity with Section-508 and WCAG 2.1AA Accessibility requirements, standards, and testing tools
  • Experience developing knowledge of complex domain and systems
  • Ability to work across multiple applications, components, languages, and frameworks
  • Experience working in a cross-functional team, including research, design, engineering, and product
  • Experience working in or with government agencies, especially the VA
  • You are a U.S. Veteran

At Agile Six, we are committed to building teams that represent a variety of backgrounds, perspectives, and skills. Even if you don't meet every requirement, we encourage you to apply. We’re eager to meet people who believe in our mission and who can contribute to our team in a variety of ways.

Salary and Sixer Benefits

To promote equal pay for equal work, we publish salary ranges for each position.

The salary for this position is $117,102-$123,107

Our benefits are designed to reinforce our core values of Wholeness, Self Management and Inclusion. The following benefits are available to all employees. We respect that only you know what balance means for your life and season. While we offer support from coaches, we expect you to own your wholeness, show up for work whole, and go home to your family the same. You will be seen, heard and valued. We expect you to offer the same for your colleagues, be kind (not bossy), be caring (not directive) and ready to participate in a state of flow. We mean it when we say “We build better by putting people first”.

All Sixers Enjoy:

  • Self-managed work/life balance and flexibility
  • Competitive and equitable salary (equal pay for equal work)
  • Employee Stock Ownership (ESOP) for all employees!
  • 401K matching
  • Medical, dental, and vision insurance
  • Employer paid short and long term disability insurance
  • Employer paid life insurance
  • Self-managed and generous paid time off
  • Paid federal holidays and Election day off
  • Paid parental leave
  • Self-managed professional development spending
  • Self-managed wellness days

Hiring practices

Agile Six Applications, Inc. is an Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, national origin, ancestry, sex, sexual orientation, gender identity or expression, religion, age, pregnancy, disability, work-related injury, covered veteran status, political ideology, marital status, or any other factor that the law protects from employment discrimination.

Note: We participate in E-Verify. Upon hire, we will provide the federal government with your Form I-9 information to confirm that you are authorized to work in the U.S. This role is required to work from the contiguous United States. Unfortunately, we are unable to sponsor visas at this time.

If you need assistance or reasonable accommodation in applying for any of these positions, please reach out to careers@agile6.com. We want to ensure you have the ability to apply for any position at Agile Six.

Please read and respond to the application questions carefully. Interviews are conducted on a rolling basis until the position has been filled.

 

Apply for this job

7d

Intermediate Full Stack Developer

MedfarMontréal, Canada, Remote
sqlazurec++.nettypescriptangularjavascriptreactjs

Medfar is hiring a Remote Intermediate Full Stack Developer

Description du poste

À titre de Développeur•euse Full-Stack Intermédiaire , vous serez membre d’une équipe de développement produit. Vous participerez à l’architecture, la conception, l’implémentation et le déploiement de nouvelles fonctionnalités logicielles développées pour enrichir l’écosystème des produits offerts par MEDFAR, produits qui cherchent à changer le milieu des soins de santé en proposant de nouvelles pratiques et innovations technologiques. 

Le•la candidat•e détient idéalement : une expérience dans l’élaboration de solutions logicielles à grande échelle; d’excellentes aptitudes de communication; une mentalité rigoureuse et analytique avec une approche de résolution de problème axée sur les données.

Principales responsabilités

  • Traduire les besoins et la vision de l'entreprise en une architecture adéquate (à la fois logicielle et matérielle);
  • Sélectionner les technologies et les méthodes appropriées; capacité à évaluer l'impact de ces choix sur l’ensemble des opérations d’affaires;
  • Concevoir et développer des architectures d'applications Web robustes, résilientes, sécurisées et évolutives, tant au niveau front-end que back-end;
  • Participer à l'amélioration continue de nos processus de développement de logiciels;
  • Aider au support des autres membres de l'équipe en ce qui concerne le coaching, la supervision et la révision de code.

Qualifications

Qui vous êtes 

  • De 4 à 5 ans d’expérience dans l'architecture et le déploiement de systèmes dans des environnements infonuagiques;
  • Expérience en automatisation de tests (unité, intégration, front-end); avec les pipelines CI / CD, et les processus DevOps;
  • Connaissance approfondie de l'architecture d'application .NET et de la programmation C#;
  • Compétences avancées en programmation JavaScript ou Typescript;
  • Expérience avec un framework front-end (ReactJS, Angular, VueJS, etc.) ainsi qu’avec SQL Server, de la programmation SQL et analyse / optimisation de performance;
  • Connaissance des meilleures pratiques de sécurité;
  • Capacité à communiquer couramment en anglais et en français (atout).
  • Connaissance du domaine d’affaires de l'industrie des soins de santé (atout);
  • Connaissance avancée de l'architecture logicielle et d’infrastructure dans le cadre Microsoft Azure (atout). 

See more jobs at Medfar

Apply for this job

11d

Fullstack Software Engineer

Jochen Schweizer mydays GroupMünchen, Germany, Remote
agileDesignmobileuiAWSbackendfrontend

Jochen Schweizer mydays Group is hiring a Remote Fullstack Software Engineer

Job Description

​​​​​​​We are seeking a dynamic individual to join our team as a Fullstack Software Engineer, where you'll play a pivotal role in crafting and enhancing our customer-facing products, elevating the shopping experience to new heights. You'll be at the forefront of innovation, collaborating closely with software engineers, product owners, and UI/UX designers to deliver end-to-end solutions that exceed expectations. If you're passionate about building scalable, high-performance applications and thrive in a collaborative, agile environment, we want to hear from you.

  • Design, implement, and maintain customer-facing products to enhance the shopping journey
  • Enhance custom tooling and libraries to streamline development processes
  • Collaborate with software engineers, product owners, and UI/UX designers to deliver end-to-end solutions
  • Passion for crafting solutions that exceed customer expectations
  • Promote knowledge sharing and mentorship, fostering a collaborative team environment
  • Solve problems with an agile mindset and full-stack approach

Specialization in Frontend:

  • Develop mobile-first, user-centric frontend applications prioritizing search engine visibility and performance
  • Build robust, maintainable frontend applications and REST interfaces
  • Proficiency in React or similar declarative UI frameworks

Specialization in Backend:

  • Architect and develop microservices and self-contained applications
  • Foster a polyglot persistence environment focusing on scalability and cloud readiness
  • Utilize event-driven and hexagonal architectures

Qualifications

  • Experience designing and implementing customer-facing products
  • Strong collaboration skills with software engineers, product owners, and UI/UX designers
  • Proficiency in agile methodologies
  • Ability to thrive in a collaborative, agile environment
  • Proficiency in frontend development
  • Experience with React or similar frameworks
  • Familiarity with AWS or other cloud environments

See more jobs at Jochen Schweizer mydays Group

Apply for this job

13d

Senior Full Stack Engineer

TruebillSan Francisco, CA, Washington, D.C., New York City, N.Y., Remote (USA)
postgresDesigngraphqlc++postgresqltypescriptbackend

Truebill is hiring a Remote Senior Full Stack Engineer

ABOUT ROCKET MONEY ????

Rocket Money’s mission is to empower people to live their best financial lives. Rocket Money offers members a unique understanding of their finances and a suite of valuable services that save them time and money – ultimately giving them a leg up on their financial journey.

ABOUT THE TEAM ????

Team Insight's mission is to support the personal finance features that make Rocket Money an integral part of our members’ everyday financial journey. Whether it’s tracking their spending, analyzing their recurring bills and subscriptions, or managing their transactions, Team Insight’s goal is to build incredible interfaces (and the backend services that power them) that make it easy for our members to understand their financial habits.

Team Insight owns the core personal finance features that all of our members use. If you’re excited about building highly scalable features that work on the scale of millions of monthly active users, this is the team for you.

IN THIS ROLE, YOU'LL:

  • Work alongside a team to implement, iterate, and debug product features that drive forward both the company and the user.
  • Own projects from end to end, making key decisions in the implementation of new features that balance technical concerns with business concerns.
  • Develop with TypeScript across the stack, building user interfaces using React Native and the backend support required to power them with Node & GraphQL.
  • Be a steward of good user experience, ensuring that the interfaces we present our users are performant, understandable, and delightful.
  • Help to maintain our high technical bar, participating in code reviews and design discussions to ensure that we're applying appropriate rigor to our software development process.
  • Develop an understanding of our users to build and measure features which help them better understand and improve their finances.

ABOUT YOU ????

  • You have 5+ years of professional experience working with some combination of Node/TypeScript, React, GraphQL, and Postgres (or similar relational database).
  • You're both a student and a teacher, continually seeking to grow as an engineer and help those around you grow as well.
  • You're not just interested in what you're building, but also why you're building it. You want to see the bigger picture of how the software you're building is benefitting our users.
  • Experience with our stack (TypeScript, React Native, PostgreSQL) is a plus.
  • You understand observability and enjoy digging into the details to solve performance and user experience issues.
  • You thrive in a growing organization, and are not afraid of a challenging problem. In fact, you confront problems head on and take the lead on the solution.

WE OFFER ????

  • Health, Dental & Vision Plans
  • Competitive Pay
  • Matching 401k
  • Unlimited PTO
  • Lunch daily
  • Snacks & Coffee 
  • Commuter benefits

Additional Information: Salary range of $150,000 - $185,000/year + bonus + benefits. Base pay offered may vary depending on job-related knowledge, skills, and experience.

Rocket Money is an Affirmative Action and Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, or protected veteran status and will not be discriminated against on the basis of disability.

Pursuant to the San Francisco Fair Chance Ordinance, we will consider for employment qualified applicants with arrest and conviction records.

See more jobs at Truebill

Apply for this job

15d

IOT Full Stack Engineer

MetioraMadrid, Spain, Remote
sqlXamarinmongodbazurescrumiosgitjavac++androidpythonAWSfrontend

Metiora is hiring a Remote IOT Full Stack Engineer

Descripción del empleo

Estamos buscando a un/a #excepcional IOT Full stack engineer ???? que sea capaz de entender los retos de nuestros clientes, hacerlos suyos y que nos ayude a establecer relaciones a largo plazo con ellos, garantizando el éxito y la ejecución de los proyectos.

¿Qué esperamos de tu perfil profesional? 

  • Grado en Computer Science, Telecomunicaciones o electrónica
  • Al menos 2 años de experiencia en proyectos reales
  • Proactividad y pasión por la tecnología
  • Ganas de trabajar en equipo
  • Curiosidad intelectual y persistencia para resolver problemas

 

Requisitos

Necesitamos????

  • Experiencia desarrollo, diseño y prototipo de hardware y electrónica (Arduino, Raspberry Pi, Intel IoT Platform, PICs, Zigbee)
  • Experiencia con redes de comunicación y protocolos: TCP/IP, HTTP, FTP, MQTT 
  • Experiencia con entornos cloud (Azure, AWS, GCP)
  • Lenguajes de programación: Python, C#
  • Enfocado en la calidad, escalabilidad y código limpio
  • Bases de datos (SQL y derivados)
  • Web frontend (Django / Celery)
  • Metodologías ágiles (SCRUM)
  • Bases de datos no relacionales (MongoDB / Redis / Clickhouse)
  • Pruebas unitarias e integración continua
  • Experiencia con control de versiones (SVN / GIT)
  • Buen nivel de inglés

Valorable????

  • Experiencia con interfaces inalámbricas: 802.15.4, LoRaWAN, Bluetooth, BLE 4.0, WiFi, 3G, GPS, RFID
  • Experiencia con arquitecturas de bus digitales e interfaces (RS-232, USB, UART, CAN-Bus)
  • React/Node.JS
  • Desarrollo de aplicaciones móviles (iOS & Android con Xamarin)
  • C++, Java
  • Experiencia colaborando en proyectos Open Source
     

See more jobs at Metiora

Apply for this job

16d

Senior Software Engineer, Full-stack

TaniumRemote, Canada
agileBachelor's degreesalesforceDesigngraphqlapigitrubyjavac++jenkinspythonbackendNode.js

Tanium is hiring a Remote Senior Software Engineer, Full-stack

The Basics

As a Senior Software Engineer at Tanium, you will build and maintain best-of-breed products as part of a nimble development team. Tanium focuses on a customer engagement model and feedback process to ensure our products are designed the right way from the beginning. When new products ideas are identified, our software engineers design, develop, test, and deploy the products from the ground up, while iterating with product management and customers for feedback and input.

What you'll do

  • Build and maintain Tanium's products alongside an agile development team
  • Design, develop and test new product ideas from the ground up while working with product management for feedback and input
  • Work on small teams that tackle big challenges in common components like a common data service tasked with unifying and consolidating endpoint data across the entire ecosystem, handling time series data that drive dashboarding and reporting, and exposing data externally through GraphQL enabling partners (like Salesforce) to easily integrate
  • Delivering higher level services enabled by our core services that directly enable our products and focus on everything from security to operations to auditing

 

Education

  • Bachelor's degree or equivalent experience
  • CS Degree preferred

Experience

  • 5+ years industry experience
  • Experience designing and building high-impact, high-performance, scalable, observable, and maintainable backend services and APIs 
  • Knowledge of at least one of Golang (preferred), Node.js, Python, Ruby, Rust, or Java
  • Experience with HTTP API design and development
  • Experience with modern software engineering development and automation tools like git and Jenkins

Other

  • Demonstrates sound judgment for balancing between rapid development, long-term code maintainability and supportability
  • Believes in the power of and the need for writing automated tests as part of development
  • Experienced debugger who can put out fires under pressure when things go wrong in production environments
  • Has knowledge of a variety of modern software frameworks (server side & browser side) and the versatility to learn new tools

About Tanium 

Tanium, the industry’s only provider of converged endpoint management (XEM), leads the paradigm shift in legacy approaches to managing complex security and technology environments. Only Tanium protects every team, endpoint, and workflow from cyber threats by integrating IT, Operations, Security, and Risk into a single platform that delivers comprehensive visibility across devices, a unified set of controls, and a common taxonomy for a single shared purpose: to protect critical information and infrastructure at scale. Tanium has been named to the Forbes Cloud 100 list for six consecutive years and ranks on Fortune’s list of the Best Large Workplaces in Technology. In fact, more than half of the Fortune 100 and the U.S. armed forces trust Tanium to protect people; defend data; secure systems; and see and control every endpoint, team, and workflow everywhere. That’s the power of certainty. Visit www.tanium.com and follow us on LinkedIn and Twitter.

On a mission. Together. 

At Tanium, we are stewards of a culture that emphasizes the importance of collaboration, respect, and diversity. In our pursuit of revolutionizing the way some of the largest enterprises and governments in the world solve their most difficult IT challenges, we are strengthened by our unique perspectives and by our collective actions.   

We are an organization with stakeholders around the world and it’s imperative that the diversity of our customers and communities is reflected internally in our team members. We strive to create a diverse and inclusive environment where everyone feels they have opportunities to succeed and grow because we know that only together can we do great things. 

Each of our team members has 5 days set aside as volunteer time off (VTO) to contribute to the communities they live in and give back to the causes they care about most.   

What you’ll get

The annual base salary range for this full-time position is C$95,000 to C$280,000. This range is an estimate for what Tanium will pay a new hire. The actual annual base salary offered may be adjusted based on a variety of factors, including but not limited to, location, education, skills, training and experience.

 

 

For more information on how Tanium processes your personal data, please see our Privacy Policy.

See more jobs at Tanium

Apply for this job

16d

Tech lead Full Stack

DevoteamRabat, Morocco, Remote
agileDesignmongodbsassgitjavadockerpostgresqlmysqltypescriptcsskubernetesangularAWSjavascript

Devoteam is hiring a Remote Tech lead Full Stack

Description du poste

LES MISSIONS DU DEVELOPPEUR FULL-STACK JAVA/ANGULAR

  • Vous interviendrez sur les nombreux projets et problématiques de nos clients,
  • Vous participerez activement aux phases projet (analyse/développement, mise en place
    et livraison) en proposant des solutions.
  • Vous réaliserez “from scratch” des projets,
  • Vous adresserez les problématiques d’architecture, de testabilité, de maintenabilité en
    proposant des solutions,
  • Nous partagerons les bonnes pratiques et sujets innovants quotidiennement,
  • Nous apprendrons grâce à vous et vous apprendrez de nous,
  • Vous participerez à la vie du pôle web (BBL, crossDT, soirée technique, …),

LE CADRE DU DEVELOPPEMENT FULL-STACK JAVA/ANGULAR

  •  Java 10+ (Spring Boot, Spring Security, Spring JPA, Spring Data, Maven, Gradle), J2EE,Hibernate.
  • JavaScript (TypeScript, Angular 6+), SASS, Karma, Jasmine.
  • PostgreSQL, DynamoDB. MongoDB, MySQL, MS Server, H2.
  • AWS, Google Cloud, Microsoft Azure.
  • Git, Docker (Swarm, Rancher, Kubernetes, Compose).
  • Architecture SOA, WOA, Microservices.
  • Nous opérons dans un cadre de Devops (CI/CD), de la manière la plus agile possible.

Qualifications

De formation Bac+5, d’une École d’Ingénieur ou équivalent, tu es non seulement capable d’apprendre et de réaliser des développements en technologies web innovantes mais aussi de comprendre, débugger et maintenir des bases de code moins récentes.

Tu sais prendre du recul sur tes réalisations et celles de tes collègues, ainsi que proposer et mettre en places des améliorations. La qualité, la robustesse, l’optimisation et les performances, ainsi que la précision de l’interface sont des concepts qui importent pour toi.

Nous recherchons des personnes ayant déjà +5 années d’expérience en développement Java et Angular, ainsi qu’en intégration graphique & responsive design (HTML, CSS), et qui ont l’envie d’intervenir sur des projets ambitieux et de partager leur passion.

Alors si tout ceci te correspond, si tu souhaites progresser et produire, apprendre et partager, rejoins-nous !

See more jobs at Devoteam

Apply for this job

17d

Senior Full Stack Software Engineer - Cloud Applications

JitterbitSão Paulo, Brazil, Remote
DesignapijavadockerelasticsearchmysqltypescriptcsskuberneteslinuxangularAWSjavascriptNode.js

Jitterbit is hiring a Remote Senior Full Stack Software Engineer - Cloud Applications

Job Description

Jitterbit is seeking a Senior Full Stack Software Engineer to join our Cloud Applications team. Jitterbit is an iPaaS (Integration as a Service) and API Management platform who has been recognized in the leader quadrant of Gartner for five straight years. Our customers use our iPaaS and APIM platform to solve mission critical business problems. What is our challenge? To make it easy to integrate our customers’ systems. In order to do this, we need to build and create a SaaS offering that is reliable, stable, and scalable for our customers. Do you have the design, architecting, and code-writing capabilities to take on this challenge? And can succeed in a big way?

ABOUT THE TEAM

The engineering team at Jitterbit believes that the quality of our code reflects directly on us as professionals. We are relentless about crafting a product that is innovative and delivers a memorable user experience; an experience that is fast and robust. As a key engineer on our team, you will collaborate with other engineers, product management, and operations. Our culture is fun, fast-paced, performance-oriented, open, and collegial. We are constantly pushing the technology envelope to the edge! We are very distributed and our culture is set up to make all of us very effective working remotely. We believe in hiring talent where it exists.

ABOUT THE JOB

You will be helping us build, design, and architect awesome and new capabilities on our various Cloud Application products. We are looking for a senior full stack engineer. You will be working with Angular, TypeScript, Node.js, CSS3, Nginx, Tomcat, Kafka, Elasticsearch, MySQL, Linux, Docker, and Kubernetes; to name a few of the technologies we use in our Cloud Apps team. You will have full lifecycle responsibilities to create robust, scalable, and distributed systems that operate flawlessly 24x7x365. You will have an opportunity to learn new things. We’re always expanding into new areas, exploring new technologies and pushing the frontier of our platform.This is an exciting opportunity to work in a highly innovative environment with new technologies as we continue to extend our market leading position.

Qualifications

ABOUT YOU

You are an engineer who can turn ideas into extremely reliable and scalable designs. You code in such a way that other engineers find your code easy to comprehend, modify, and build upon. You believe in the power of Integration and APIs to transform how systems are integrated and how applications are built.

You will be successful in this role if you:

  • Enjoy helping and mentoring others around you as you grow and become a successful engineer and developer
  • Have excellent written and verbal communication skills
  • Are capable of working in a distributed team and able to excel in a remote culture
  • Are self-driven and able to work on key initiatives
  • Take pleasure in making things happen and listen to the input from peers
  • Are able to make data driven decisions
  • Are a believer in a best idea strategy regardless of where or who ideas come from

We are looking for:

  • 5-8+ years of experience in building large scale distributed applications.
  • Strong experience building multi-tenant SaaS applications
  • Strong problem-solving, debugging, and analytical skills with great attention to detail
  • Experience with Microservices and Cloud-based architectures/design patterns

Technical Skills and Experience:

  • Excellent JavaScript, CSS and HTML authoring skills.
  • Proficiency with Javascript, TypeScript, Java Node.js, or Go.
  • Familiar with application deployment via Docker and/or Kubernetes.
  • Hands-on experience with AWS services such as DynamoDB, S3, or CloudFront.
  • Bonus: Experience using DataDog APM and logging.
  • Bonus: Experience developing and releasing using CI/CD pipelines, such as GitHub Actions

See more jobs at Jitterbit

Apply for this job

19d

Specialist, Full Stack Developer II

Team RubiconLos Angeles, CA OR Remote
sqlDesignhtml5qac++.netangularjavascriptbackendfrontend

Team Rubicon is hiring a Remote Specialist, Full Stack Developer II

Team Rubicon (TR)is seeking aSpecialist, Full Stack Developer II. TheFull Stack DeveloperIIwill workalongsidethe rest of the Technology Department to build and updatecustom tools and products to enable Team Rubicon’s missionon a daily basis. This will requirethe ability to collaborate, plan, and execute as well asdemonstratedskills in software design andimplementation.TheFull Stack Developer IIwillbe responsible foradvanced configuration, development, implementation, testing, and deployment of web-based applications, business intelligence solutions, and integration of applications and data. 

Evey day will be a challenge, but every month brings new opportunities for an organization that is quickly becoming a household name in disaster response. This position reports to TR’sManager, Business Applicationsand is based out of TR’s National Headquarters in Los Angeles, CA or remote within the United States.

Duties: 

  • Software Development: Design, develop, andmaintainscalable web applications using .NET Core, Angular, and SQL technologies. 
  • Frontend Development: Implement user-friendly interfaces and user experiences using Angular framework, HTML5, CSS3, and JavaScript. 
  • Backend Development: Create robust APIs and backend services using .NET Core framework for seamless integration with frontend components. 
  • Database Management: Design andoptimizeSQL database schemas, write complex queries, and ensure data integrity and security. 
  • Code Reviews and Testing:Participatein code reviews to ensure code quality, conduct unit tests, and contribute to the overall software testing process. 
  • Documentation: Document technical specifications, architectural designs, and code implementation details for future reference and collaboration. 
  • Collaboration: Work closely with cross-functional teams including UI/UX designers, product managers, and QA engineers to deliver high-quality software solutions. 
  • Problem Solving: Troubleshoot and debug issues,identifybottlenecks, and implement effective solutions tooptimizeapplication performance. 
  • Continuous Improvement: Stay updated with industry trends, emerging technologies, and best practices in software development. Propose and implement process improvements to enhance team productivity and software quality. 

Experience and Background:

  • Minimum of 3-5 years of professional experience in software development. 
  • Strong understanding of software development principles, design patterns, and best practices. 
  • Experience with version control systems such as Git and collaborative development tools like JIRA. 
  • Familiarity with RESTful API design and implementation, as well as microservices architecture. 
  • Soft Skills: 
    • Excellent communication and collaboration skills with the ability to work effectively in a team environment. 
    • Self-motivated with a proactive approach to learning and skill development. 

Special Requirements: 

  • This is a full-time, hybridrole based in Los Angeles, CA(with the potential to be a remote role based anywhere within the United States) and provides a flexible & non-traditional work schedule (relocation expenses not provided).

  • This role alsoEveningand weekend schedule supporting operations and tech team[Additional requirements such as evening/weekend schedule requirement and local/other travel requirements].
  • Travel: At least 15% travel for in-person design sessions and meeting with stakeholders.

Job Type:  

  • Full-time, salary, exempt 

Job Tier:  

  • Specialist 

Pay Range: 

  • $80,514.00 – $137,241.60 per year 

Cultural Principles:   

  • Mission First, Greyshirt Always: Anyone joining TR must understand that our mission to provide disaster response comes first 
  • Step into the Arena: TR needs leaders who aren’t afraid to dare to be great  
  • Everyone Has A Role Know It: Ability to successfully navigate a fast-paced, high-growth environment and solve problems in the face of ambiguity 
  • GSD: We are entrepreneurial, resourceful and determined no matter how chaotic the situation 
  • Change Your Socks: We take care of ourselves and each other so we are best equipped to serve those in greatest need 
  • Adults Only: Every team member is an adult until proven otherwise 
  • Your Mother’s A Donor: Every leader must be committed to fiduciary responsibility, transparency and financial stewardship 

Perks of the Team:   

  • Unlimited Flexible Paid Time Off  
  • Generous holiday schedule (including a paid week off between winter holidays)  
  • Matching 401k contributions up to 4% with no vesting requirement 
  • 100% company-paid health benefits for employees and their dependents  
  • Professional development, leadership development and events/conferences 
  • Paid time off to volunteer with the non-profit of your choice 
  • One-week all-inclusive onboarding experience 

The health of our staff and volunteers is a top priority for Team Rubicon. We require all new employees to be fully vaccinated against COVID-19 or to obtain an approved exemption as an accommodation. If you are not willing to be vaccinated, your offer will be rescinded unless Team Rubicon approves a valid exemption and reasonable accommodation for qualifying religious or medical reasons (or for other categories protected by applicable law. This policy is intended to comply with all state and local laws, including all applicable equal employment opportunity laws. 

Learn more about Team Rubicon: 

Team Rubicon is an equal opportunity employer and is committed to not only including but actively seeking out a diversity of lifestyles, experiences, perspectives, and voices in order to foster inclusion, growth, and innovation. Your candidacy will be considered without regard to race, color, religion, gender, gender identity or expression, sexual orientation, national origin, genetics, disability, age, or veteran status. 

See more jobs at Team Rubicon

Apply for this job

Consensys is hiring a Remote Senior Fullstack Engineer (Infura)

Job Application for Senior Fullstack Engineer (Infura) at Consensys

See more jobs at Consensys

Apply for this job

23d

Fullstack Technical Lead

In All Media IncArgentina Remote
agilesqlDesignazurec++.nettypescriptcssangular

In All Media Inc is hiring a Remote Fullstack Technical Lead

Fullstack Technical Lead

In All Media

About the Client:

Global technology and engineering company dedicated to delivering innovative solutions to our customers in the Life Sciences industry. As part of our commitment to excellence, we are seeking a talented Tech Lead to support our software development capabilities and lead the replacement of our current ActivePDF solution with a customized, cost-effective alternative. This is an exciting opportunity to significantly impact the client and its customers by delivering cutting-edge software solutions.

We are looking for a highly skilled Tech Lead to join our Life Sciences group and lead the development of a customized, royalty-free alternative to our current ActivePDF solution. The successful candidate will have extensive experience in software development, strong leadership skills, and a passion for driving innovation. As the Tech Lead, you will be responsible for leading a team of developers, defining technical architecture, and ensuring the successful delivery of high-quality software solutions.

Key Responsibilities:

  • Lead the software development team in the design, development, and implementation of a customized, cost-effective alternative to our current ActivePDF solution.
  • Define technical architecture, design patterns, and coding standards to ensure scalability, reliability, and maintainability of the software solution.
  • Collaborate with product owners, business stakeholders, and cross-functional teams to gather requirements, define project scope, and prioritize tasks.
  • Mentor and coach team members on coding best practices, software development methodologies, and emerging technologies.
  • Drive continuous improvement and innovation by identifying opportunities for process optimization, automation, and tooling enhancements.
  • Ensure adherence to coding best practices, version control, build, deployment, and test management processes.
  • Monitor project progress, identify risks and issues, and implement mitigation strategies to ensure successful project delivery.
  • Act as a technical liaison between the development team and other stakeholders, providing guidance and support as needed.

Requirements:

  • Strong communication (verbal and written) and interpersonal skills.
  • Proven ability to work autonomously and as part of a collaborative team.
  • Demonstrated experience developing software in an organization using the Scaled Agile Framework (SAFe).
  • Familiarity with coding best practices, design patterns, and software development lifecycle methodologies.
  • Proficiency in Windows, Angular (10 and above), Typescript, HTML, CSS, C#, .NET Framework 4.1 and above (ASP.Net, MVC, MVVM), .Net Core 3.0 and above, Azure (CI/CD), SQL, and GIT.
  • 10+ years of experience in software development, including 4+ years in a technical leadership role.
  • Nice to have: Familiarity with Windows Log (nLogger), knowledge of self-signed certificates, and experience with Active PDF.

Benefits:
100% remote work.
Payments made from the US.
International teams.
Exciting projects; all our clients are top-notch US-based companies.
Hourly rates in US dollars.
Full-time and long-term projects.
Contract as a vendor.

See more jobs at In All Media Inc

Apply for this job

24d

Senior Fullstack Engineer

carsalesSydney, Australia, Remote
terraformairflowvuetypescriptangularbackendfrontendNode.js

carsales is hiring a Remote Senior Fullstack Engineer

Job Description

What you will do

We're hiring a Senior Full-stack Engineer (frontend focus) who will join a team of talented developers, continuing to work with our wider Tech and Product teams and clients. 

This is an exciting role, which will include:

  • You'll work in cross-functional full-stack team which prioritises software craftsmanship.
  • You'll have opportunities to work on all aspects of the product, including frontend (Vue.JS), backend (Nest.JS) , CI/CD (CircleCI), Cloud (Terraform + GCP), Data Engineering (Airflow, BigQuery, Apache Beam)
  • Your work will have a real impact on the business and our clients, including Weatherzone, the NRL, and OzBargain.

Qualifications

What you bring to the role

  • A good understanding of frontend engineering
  • An interest in User Experience, and a willingness to understand what the end-user is trying to achieve
  • Proficient with Typescript
  • Strong knowledge of Node.js REST APIs to read and understand the code, and make basic changes.
  • experience with modern frontend frameworks (Vue, React, Angular, etc) is essential.
  • Professional experience with Vue will be a significant advantage.

See more jobs at carsales

Apply for this job

26d

Senior Software Engineer (Full Stack)

Procore TechnologiesBangalore, India, Remote
postgresDesignUXrubyjavatypescriptbackendfrontend

Procore Technologies is hiring a Remote Senior Software Engineer (Full Stack)

Job Description

What if you could use your technology skills to develop a product that impacts the way communities’ hospitals, homes, sports stadiums, and schools across the world are built? Construction impacts the lives of nearly everyone in the world, and yet it’s also one of the world’s least digitized industries, not to mention one of the most dangerous.

That’s why we’re looking for an experienced Senior Full-Stack Software Engineer to join Procore’s journey to revolutionize a historically underserved industry. In this role, you’ll join our highly collaborative Product and Engineering organization to drive the technical direction of our projects.

This position will report to a member of our Engineering Management team and has the opportunity to work hybrid from the Bengaluru or Pune office. We’re looking for someone to join our team immediately.

What you’ll do:

  • Develop mission-critical systems using Java, Ruby, React and Postgres
  • Contribute to designing and building a system that is aligned with Procore’s technical vision of a service-oriented architecture
  • Work up and down the stack to ship code for our Rails backend and our React frontend, and dive deep into the database layer to handle complex querying needs
  • Collaborate with Engineering, Product, and UX to design and build solutions that delight users and solve critical business problems
  • Develop teammates by conducting code reviews, providing mentorship, pairing, and training opportunities
  • Serve as a subject matter expert in a domain, including processes and software design that help guide others to create and maintain a healthy codebase

What we're looking for:

  • Bachelor’s Degree in Computer Science, a related field, or comparable work experience
  • 5+ years experience in Object-Oriented Program fundamentals, Test Driven Development and Design principles (Java, Ruby, React, Typescript)
  • Experience designing and building software in a Service-Oriented Architecture
  • Track record of anticipating technical problems that will fall out of major projects and designing solutions to overcome those problems
  • Demonstrated expertise in building and/or significantly improving large features, supporting technological areas, and architecture initiatives
  • Experience working with our stack of Java, React, and Postgres
  • Strong experience documenting and bringing team clarity to complex solutions
  • Time-honed expertise with modern web development across the entire spectrum of development, testing, staging, deploying, and monitoring
  • A curious mind that is driven to innovate and solve customer problems

Qualifications

See more jobs at Procore Technologies

Apply for this job

27d

Full Stack Software Engineer (Mid-Level)

Property MeldUnited States Remote
remote-firstnosqlDesigntypescriptpython

Property Meld is hiring a Remote Full Stack Software Engineer (Mid-Level)

Software Engineer

Welcome to the future of property maintenance! Property Meld’s vision is to radically improve how the property management industry handles maintenance. If you’ve ever had a maintenance issue at your housing rental, you know how much of a pain it can be to get it fixed quickly and reliably. Join Property Meld and help solve the maintenance headache!

We’re a small company but our growth potential is huge! Recognized as one of the fastest-growing startups in property management, we are looking for a motivated software engineer who wants to have an immediate impact on our journey.

Your Role
As a software engineer, you will tackle difficult engineering problems while developing and shipping new features for our product, ensuring that they are performant, scalable, and well-engineered. The Property Meld services are used by hundreds of thousands of people and dozens of partners. You will help scale Property Meld’s services by developing new web app features, improving our CI/CD processes, profiling and fixing performance issues, and solving technical challenges in a collaborative team environment. We’re looking for someone who:

  • Can ship software with exceptional quality in a high-velocity team
  • Has experience in some or all of the following: Python, Typescript, Django, React, and various data stores (relational databases, NoSQL databases)
  • Can solve problems without adding accidental complexity
  • Can take ownership of projects and architect them from the ground up to be scalable, maintainable, and elegant in design
  • Is an expert in at least one area of building web applications and proficient in other areas
  • Has a bias for action
  • Has 3+ years of professional software development experience
  • Experience operating the infrastructure of a public-facing web site preferred

We recognize that good engineers can learn any technology so don’t hesitate to apply if your background is in other technologies. Our focus is on delivering an amazing product at an impressive rate to our customers.

What you’ll get

  • A remote work environment and a work laptop of your choice.
  • Great work-life balance
  • The chance to build and scale out an ambitious project
  • A team environment with a culture of execution
  • Involvement in the decision-making process
  • Great teammates that care about your success
  • A chance to help solve the headache that is maintenance for millions of people

About Our Pay and Benefits

The salary range for this position is

$100,000 - $145,000

*Candidates MUST be eligible for full-time employment in the United States.

The product team at Property Meld is a remote-work organization. We require 4 hours of overlap time, daily, with the Mountain Time Zone. The position is 99% remote, with the following non-pandemic exceptions: Once a year, the total company gets together for a week of getting to know each other and to better understand the big picture of the company and how we work in each department and role. Two times per year the product team gets together in the same physical location to get to know each other better and work through interesting challenges together. In addition, once a quarter, on your schedule, you are expected to visit with a customer and shadow them to learn how they are using and not using our product.

We value diverse points of view and know that our differences make us stronger. We believe in fostering a place to work that is open, welcoming, diverse, inclusive, and healthy. We strongly encourage applications from individuals who are under-represented in the tech industry, across color, creed, race, ethnic and national origin, physical ability, gender, sexual identity, or any other basis.

Our benefits package is designed to be a part of our employees’ story of living well. We believe in our culture of trust and respect, where we have reasonable working hours, vacation time used for rejuvenation, employee wellness & health, and employee development,

  • Healthcare through Wellmark Blue Cross Blue Shield
  • Dental through Beam
  • Vision through Beam
  • 401K through Guideline
  • $25,000.00 Life Insurance Policy sponsored by Property Meld
  • Four Weeks PTO annually, and allotted upon hire
  • Employee Equity Options Program
  • Personalized Remote Work Equipment. You select what equipment will work best for you.
  • Travel Opportunities
  • Meetups with the company 1-3 times a year


*Candidates must be eligible for full-time employment in the United States.


See more jobs at Property Meld

Apply for this job

28d

Fullstack Engineer

UserTestingBarcelona - Remote
Designc++typescriptkubernetesNode.js

UserTesting is hiring a Remote Fullstack Engineer

We’re UserTesting, a leader in experience research and insights; we believe the path to human understanding and great experiences start with a shared understanding—seeing and hearing how another person engages with the world around them and taking in their perspective. Working at UserTesting, you will be empowered to help organizations  discover the human side of business–transforming how they work, collaborate, innovate, and bring new products and experiences to market. This is what inspires us, and it’s how we enable companies to connect with their audiences naturally and organically through an experience that is uniquely, and intentionally human.

A trusted company by top brands for 15+ years, UserTesting, recently merged with UserZoom, has over 3,400 customers in 50 countries, including 75 of the Fortune 100 companies. Joining our team means being part of a passionate group focused on transforming how companies learn from and understand their customers. Come join us and help us build the engine for human understanding.

The Opportunity

As part of the Engineering Team, you will have a great opportunity to contribute to building on our SaaS platform. Working alongside our global team you will be responsible for creating something truly amazing - the Human Insights industry is an exciting place to be right now. As UserTesting grows, so does our focus on your career and personal development. More importantly, the team here at UserTesting is both supportive and welcoming of new team members, with plenty of social events (if you like to get involved).

The Team

The Engineering team is an integral part of our organization, with members spanning many global locations. We are committed to building effective solutions, delivering for impact, always learning, and iteratively shaping the Product to transform the business, while growing a state-of-the-art SaaS platform in a scalable and reliable way.

What you will be doing

  • Collaborate with the team to understand project requirements and translate them into clear, concise code.
  • Write, test, and debug code using a variety of programming languages.
  • Conduct unit testing to ensure code functionality and identify potential issues.
  • Contribute to code reviews, providing constructive feedback and learning from senior engineers.
  • Approach problem-solving with a proactive and independent attitude.
  • Document code clearly and concisely to ensure maintainability and collaboration.
  • Stay up-to-date with the latest software development trends and technologies.
  • Learn and adapt to new technologies as needed.
  • Assist with debugging and troubleshooting technical issues.
  • May participate in some aspects of system design and architecture (depending on project needs).
  • Great communication skills, able to understand and clarify complex matters with non-technical colleagues.

What we are looking for

  • Bachelor’s degree in computer science or equivalent.
  • You have strong technical skills and solid conceptual foundations.
  • Experience with Typescript, Node.js, and/or the React ecosystem.
  • You like Distributed Software, Microservices, and Event-driven Cloud Architectures.
  • You are familiar with or interested in learning some of our toolset: GraphQL/Apollo, gRPC, Kafka, Mongo, Kubernetes, GitHub Actions, SingleSpa, Jotai, Jest/Cypress.
  • You are in for the challenge of building highly reliable & scalable systems.
  • You are eager to learn, screen those learnings, and apply the best suited for a bounded context.
  • You have experience in discussing, spiking & benchmarking Engineering solutions.
  • You speak fluent English.
  • Familiarity with Reactive & Domain Driven Architectures.
  • Demonstrates UserTesting’s values through work product and within day-to-day team interactions.

What we offer

- Employee Assistance Program (EAP)
- Health Insurance
- Flexible retribution
- Employee Referral Program
- Professional Development Stipend
- Remote work stipend
- Wellness reimbursement 
- Volunteer days

To learn more about our team, culture, and customers, check out ourcareers page,company blog, andpress/awards. Aside from a great work environment and the opportunity to make an impact, we’re also growing the team quickly–join us!

At UserTesting, we are committed to providing more inclusive and accessible experiences for our candidates. We pride ourselves on building empathy; diverse perspectives, which we believe are the key values to creating exceptional experiences for everyone. Our commitment to providing accessible experiences is driven by this belief and our core values. If you require any accommodations or have any specific requests about how we could tailor our interview process to better suit your needs please contact us on:talentexperience@usertesting.com.If you need to speak to someone please ask!

******

UserTesting is an Equal Opportunity Employer and a participant in the U.S. Federal E-Verify program.  Women, minorities, individuals with disabilities and protected veterans are encouraged to apply.  We welcome people of different backgrounds, experiences, abilities and perspectives.  

UserTesting will consider qualified applicants with criminal histories in a manner consistent with the San Francisco Fair Chance Ordinance, as applicable.  

We welcome candidates with physical, mental, and/or neurological disabilities. If you require assistance applying for an open position, or need accommodation during the recruiting process due to a disability, please submit a request to People Operations by emailingaskPeopleOps@usertesting.com.

See more jobs at UserTesting

Apply for this job

29d

Senior JAVA Full Stack Developer

MobicaWarsaw, Poland, Remote
agilenosqlsqloracleapijavadockermysqlkubernetesbackend

Mobica is hiring a Remote Senior JAVA Full Stack Developer

Job Description

Our Customer is a leading global provider of cutting-edge payments technology solutions, dedicated to shaping the future of financial transactions worldwide. With a commitment to innovation and excellence, we connect consumers, businesses, financial institutions, and governments in over 200 countries and territories through our advanced processing networks.

Currently we are looking for Senior Full Stack Developers within JAVA technology experienced in building Front End and Back End working in Agile environment.

This is a hybrid work opportunity, requiring attendance at the customer's office in Warsaw twice a week for team relationship-building purposes.

Due to the nature of our work in the financial market, candidates will be subject to detailed background screening including education, employment history, and criminal record.

Qualifications

Basic Qualifications:

  • 8 years of work experience with a Bachelor’s Degree or at least 6 years of work experience with an Advanced Degree (e.g. Masters/MBA/JD/MD) or at least 2 years of work experience with a PhD

Preferred Qualifications:

  • Experience with tools development, automation (CI/CD, Auto Deployment, System Availability, etc.).
  • Must have a solid understanding of latest backend technologies like gPRC, REST, JSON and other relevant API standards like OAuth, SAML.
  • Extensive technical experience with full stack HTTP, JAVA REST APIs, databases, Java frameworks at scale. goLang app development is an added bonus.
  • Experience with distributed async event streaming platform especially Kafka
  • Experience with both NoSQL and SQL datastores including Oracle, MySQL, Cassandra, MongoDB. Graph DB, especially neo4J experience is an added bonus.
  • Experience with large-scale active-active systems environments managed through Kubernetes and container (Docker) technologies
  • Extended experience in Agile Release Management practices, governance, and planning. 
  • Strong ability to build and sustain working and strategic relationships across technology. 
  • Experience within container space, understands and able to quickly build and drive team to support future systems.
  • Strong leadership skills with demonstrated ability to lead global, cross-functional teams.  Strong analytical and problem solving skills.
  • Ability to maintain composure under pressure and tight deadlines.
  • Ability to ensure quality of deliverables by participating in testing activities
  • Must have experience in debugging and troubleshooting in Linux/Unix/Container based application servers such as Tomcat, VertX, WebSphere, Docker, Kubernetes environments.
  • Good to have experience setting up test setup and strategy in cloud infrastructure & technologies.

See more jobs at Mobica

Apply for this job

+30d

Software Engineer II (Full stack)

agileremote-firstkotlinfigmapostgressqlDesignvuegraphqljavapythonbackendfrontend

Parsley Health is hiring a Remote Software Engineer II (Full stack)

About us:

Parsley Health is a digital health company with a mission to transform the health of everyone, everywhere with the world's best possible medicine. Today, Parsley Health is the nation's largest health care company helping people suffering from chronic conditions find relief with root cause resolution medicine. Our work is inspired by our members’ journeys and our actions are focused on impact and results.

The opportunity:

We’re looking for a full stack engineer and leader with knowledge of frontend and backend technologies that can and enjoys building exciting new features from zero to hero that support the Parsley Health mission. You will be joining a remote team of passionate engineers.  In this role, you will work closely with engineering, product, design, clinical, marketing, and customer reliability teams. Parsley Health is an outcome driven organization and your work will directly contribute to the company objectives:  expand the business nationally, improve activation, conversion, retention, and expansion of our healthcare products.

We work in a blameless environment and we take ownership and pride in our efforts. We follow agile development pvractices and encourage each pod to tailor the processes to their needs. Our teams are built on pillars of trust, humility and continuous improvement.

What you’ll do:

  • Take ownership of technical design and implementation by working directly with product, design, and stakeholders to build out new concepts or products
  • Partner with sr members of the team to gain feedback on technical design and code plus also assist with implementation on larger projects
  • Build modern, beautiful web applications that shape our members’ experiences, empower doctors and health coaches, and support our internal team
  • Work closely with our Design teams to design, spec and estimate new projects and features
  • Work as part of an amazing team of engineers while being a technical leader and mentor other team members
  • Foster high code quality, security and set best practices

What you’ll need:

  • A full stack engineer with 2+ years of experience
  • Have  1+ years of on-the-job experience in the following technologies:
    • Front-end frameworks: React, Next, Remix, Vue, or Svelte
    • Backend languages support web services: Python, Java, Go, Kotlin or NodeJS
    • SQL relational database
  • Have a exposure to microservice patterns, domain services and front-end applications
  • Have exposure to design systems, component libraries, and/or Figma
  • Experienced in unit testing
  • Be able to diagnose and remediate issues in existing systems
  • Someone who takes a disciplined approach to development, testing, documentation, code structure and review in a team environment
  • Be able to own the development and lifecycle of at least a smaller sized feature
  • Have an entrepreneurial mindset in venture-backed growth-stage startups
  • Passionate about our mission to live healthier through revolutionary primary care, excited for the future of healthcare, and a personal belief in wellness

Our tech stack:

  • GCP is our platform for all custom application development and services
  • Services are containerized and run in containerd
  • GraphQL is our service language for applications.
  • Current languages of choice are Golang (new services) and Kotlin (legacy).
  • Managed Postgres with Cloud SQL.
  • GitHub is our repository and CI/CD service.

Benefits and Compensation:

  • Equity Stake
  • 401(k) + Employer Matching program
  • Remote-first with the option to work from one of our centers in NYC or LA
  • Complimentary Parsley Health Complete Care membership
  • Subsidized Medical, Dental, and Vision insurance plan options
  • Generous 4+ weeks of paid time off
  • Annual professional development stipend

Parsley Health is committed to providing an equitable, fair and transparent compensation program for all employees.

The starting salary for this role is between $123,250 - $145,000, depending on skills and experience. We take a geo-neutral approach to compensation within the US, meaning that we pay based on job function and level, not location.

Individual compensation decisions are based on a number of factors, including experience level, skillset, and balancing internal equity relative to peers at the company. We expect the majority of the candidates who are offered roles at our company to fall healthily throughout the range based on these factors. We recognize that the person we hire may be less experienced (or more senior) than this job description as posted. If that ends up being the case, the updated salary range will be communicated with candidates during the process.


At Parsley Health we believe in celebrating everything that makes us human and are proud to be an equal opportunity workplace. We embrace diversity and are committed to building a team that represents a variety of backgrounds, perspectives, and skills. We believe that the more inclusive we are, the better we can serve our members. 


Important note:

In light of recent increase in hiring scams, if you're selected to move onto the next phase of our hiring process, a member of our Talent Acquisition team will reach out to you directly from an@parsleyhealth.comemail address to guide you through our interview process. 

    Please note: 

  • We will never communicate with you via Microsoft Teams
  • We will never ask for your bank account information at any point during the recruitment process, nor will we send you a check (electronic or physical) to purchase home office equipment

We look forward to connecting!

#LI-Remote

See more jobs at Parsley Health

Apply for this job

+30d

Staff Software Engineer - Full-stack

Procore TechnologiesCairo, Egypt, Remote
Bachelor's degreeDesignrubyjavatypescriptkubernetespythonAWSjavascriptNode.js

Procore Technologies is hiring a Remote Staff Software Engineer - Full-stack

Job Description

​​What if you could use your technology skills to develop a product that impacts the way communities’ hospitals, homes, sports stadiums, and schools across the world are built? Construction impacts the lives of nearly everyone in the world, and yet it’s also one of the world’s least digitized industries, not to mention one of the most dangerous. That’s why we’re looking for a talented Staff Full-Stack Software Engineer to join Procore’s journey to revolutionize a historically underserved industry.

As a Staff Full-Stack Software Engineer at Procore, you’re given the unique opportunity to partner intimately with our customer base, translating their fundamental needs into technological SaaS solutions. Backed by the might of our teams, we’ll provide you with the tools and resources needed to achieve extraordinary results that render a significant impact extending beyond the boundaries of traditional engineering roles. 

This position will report into the Senior Engineering Manager for the Construction Documents Group, and is located in Cairo, Egypt. We’re looking for someone to join us immediately.

What you’ll do:

  • Help establish standards for development teams and collaborate on initiatives with infrastructure, platform, and other software engineering teams
  • Assist fellow teammates by conducting code reviews and pairing
  • Leverage our tech stack: Primarily Ruby/Rails/Node.js/React/Postgres hosted on AWS and increasingly using Kubernetes and languages such as Java and Typescript, CircleCI for Continuous Integration, and a combination of ArgoCD and an in-house tool for CD.
  • Drive critical projects, including: 
    • Scalability: We’re scaling and need engineers who are ready to take on the challenge of working on live, core systems with millions of users
    • Complex data management systems: We’re building a world-class document file management system. You’ll work through challenges like file intake, document management, large file manipulations, permissions and file revisioning.
    • Evolve our existing codebase from a monolithic Rails application into a modular system with clear, well-enforced domain boundaries and a coherent public interface
    • Participate in designing and building a system that is aligned with Procore’s technical vision of a Service-Oriented Architecture
    • Build, maintain, and develop a wide series of microservices and are looking for engineers adept at discovering new opportunities and driving them to completion.

What we're looking for: 

  • Bachelor's Degree in Computer Science or equivalent experience
  • Professional experience with React and Node.js, Ruby/Ruby on Rails or Java
  • 8+ years experience in software engineering fundamentals, Test Driven Development and Design principles (Ruby on Rails, Python, React, Javascript, Java, Node.js or similar languages preferred)
  • Experience with working on Document Management systems
  • Understanding the tradeoffs between short-term and long-term goals and balancing immediate needs with strategic initiatives
  • Experience in working with software, platforms, and infrastructure at scale (we run thousands of hosts and have millions of users) 
  • Experience in building modern Continuous Integration and Continuous Delivery systems at scale
  • Experience working with a team on large initiatives with the ability to course-correct as needed
  • Experience working with modern web development, including testing, staging, deploying, and monitoring

 

Qualifications

See more jobs at Procore Technologies

Apply for this job